Property Summary

NCBI Gene PubMed Count 72
Grant Count 72
R01 Count 32
Funding $4,445,531.55
PubMed Score 1807.39
PubTator Score 80.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
psoriasis 2.300 0.000
non-small cell lung cancer -1.765 0.000
lung cancer -2.400 0.000
interstitial cystitis 2.100 0.001
lung carcinoma -3.300 0.000
invasive ductal carcinoma 1.200 0.003
ulcerative colitis 1.500 0.000

Synonym

Accession P13686 A8K3V2 Q2TAB1 Q6IAS6 Q9UCJ5 Q9UCJ6 Q9UCJ7 TR-AP
Symbols HPAP
TRAP
TRACP5a
TRACP5b
TrATPase

Gene

PDB

1WAR   2BQ8  

Gene RIF (48)

PMID Text
27089726 Trap-5b is overexpressed in renal cell carcinoma patients with bone metastasis and bone resorption.
27069189 We identified five new biomarkers: GDF15, osteonectin, TRAP5, TWEAK, and YKL40 as being promising markers for monitoring bone metastases.
26427154 Serum levels of NTx and TRACP5b are sensitive and simple biomarkers to indicate aberrant bone metabolism in giant cell tumor of bone, and they may have a clinical significance in GCT diagnosis.
25778334 TRACP5a may be a promising chronic inflammatory marker and may play a prognostic role in cancer cachexia.
23990468 Pax6 binds endogenously to the proximal region of the tartrate acid phosphatase (TRAP) gene promoter and suppresses nuclear factor of activated T cells c1 (NFATc1)-induced TRAP gene expression.
23737138 TRACP5b has limited utility as a single marker of metabolic bone disease treatment.
23604121 Immunohistochemistry revealed that ACP5 expression was positively correlated with FoxM1 expression in human HCC tissues, and their coexpression was associated with poor prognoses
23383108 A synthetic peptide corresponding to the immunosuppressive domain (amino acids 574-592) of HIV-1 gp41 downregulates the expression of acid phosphatase 5, tartrate resistant (ACP5) in peptide-treated PBMCs
22844067 Tartrate-resistant acid phosphatase stain-ing of bone marrow osteoclasts cannot serve as a tool to determine the time of death of a patient.
22517558 The results showed that both OC and TRACP-5b values were at their highest during the ovulation period, and the activity of TRACP-5b was more significant than that of OC. Furthermore, the changes in sex hormone secretion involved in OC and TRACP-5b showed specific patterns during the menstrual cycle.
More...

AA Sequence

MDMWTALLILQALLLPSLADGATPALRFVAVGDWGGVPNAPFHTAREMANAKEIARTVQILGADFILSLG      1 - 70
DNFYFTGVQDINDKRFQETFEDVFSDRSLRKVPWYVLAGNHDHLGNVSAQIAYSKISKRWNFPSPFYRLH     71 - 140
FKIPQTNVSVAIFMLDTVTLCGNSDDFLSQQPERPRDVKLARTQLSWLKKQLAAAREDYVLVAGHYPVWS    141 - 210
IAEHGPTHCLVKQLRPLLATYGVTAYLCGHDHNLQYLQDENGVGYVLSGAGNFMDPSKRHQRKVPNGYLR    211 - 280
FHYGTEDSLGGFAYVEISSKEMTVTYIEASGKSLFKTRLPRRARP                             281 - 325
//

Text Mined References (74)

PMID Year Title
27089726 [TARTRAT-RESISTANT ACID PHOSPHATASE AS BONE'S RESORBTION MARKER IN PATIENTS WITH BONE METASTASES].
27069189 2016 Testing of a Novel Cancer Metastatic Multiplex Panel for the Detection of Bone-metastatic Disease - a Pilot Study.
26427154 2015 Serum Levels of NTx and TRACP5b in Giant Cell Tumor of Bone and its Clinical Implications.
25778334 The correlation between a chronic inflammatory marker Tartrate-resistant acid phosphatase 5a with cancer cachexia.
23990468 2013 The paired-box homeodomain transcription factor Pax6 binds to the upstream region of the TRAP gene promoter and suppresses receptor activator of NF-?B ligand (RANKL)-induced osteoclast differentiation.
23737138 2014 Limited utility of tartrate-resistant acid phosphatase isoform 5b in assessing response to therapy in osteoporosis.
23604121 2014 ACP5, a direct transcriptional target of FoxM1, promotes tumor metastasis and indicates poor prognosis in hepatocellular carcinoma.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22844067 2012 Post-mortem analysis of bone marrow osteoclasts using tartrate-resistant acid phosphatase staining: does histochemistry work and correlate with time since death?
22517558 2012 A change of osteocalcin (OC) and tartrate resistant acid phosphatase 5b (TRACP-5b) with the menstrual cycle.
More...