Property Summary

NCBI Gene PubMed Count 79
PubMed Score 1913.57
PubTator Score 80.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Multiple Sclerosis 540 0.0 0.7

Expression

  Differential Expression (7)

Disease log2 FC p
interstitial cystitis 2.100 1.1e-03
invasive ductal carcinoma 1.200 2.8e-03
lung cancer -2.400 3.7e-04
lung carcinoma -3.300 3.1e-29
non-small cell lung cancer -1.765 6.9e-17
psoriasis 2.300 2.1e-04
ulcerative colitis 1.500 1.7e-04

Protein-protein Interaction (2)

Gene RIF (55)

AA Sequence

MDMWTALLILQALLLPSLADGATPALRFVAVGDWGGVPNAPFHTAREMANAKEIARTVQILGADFILSLG      1 - 70
DNFYFTGVQDINDKRFQETFEDVFSDRSLRKVPWYVLAGNHDHLGNVSAQIAYSKISKRWNFPSPFYRLH     71 - 140
FKIPQTNVSVAIFMLDTVTLCGNSDDFLSQQPERPRDVKLARTQLSWLKKQLAAAREDYVLVAGHYPVWS    141 - 210
IAEHGPTHCLVKQLRPLLATYGVTAYLCGHDHNLQYLQDENGVGYVLSGAGNFMDPSKRHQRKVPNGYLR    211 - 280
FHYGTEDSLGGFAYVEISSKEMTVTYIEASGKSLFKTRLPRRARP                             281 - 325
//

Text Mined References (81)

PMID Year Title