Property Summary

NCBI Gene PubMed Count 28
Grant Count 2
Funding $210,168.5
PubMed Score 13.62
PubTator Score 15.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Synonym

Accession P13674 C9JL12 Q15082 Q15083 Q5VSQ5 4-PH alpha-1
Symbols P4HA

Gene

PANTHER Protein Class (2)

 Grant Application (2)

PDB

1TJC   2V5F   2YQ8   4BT8   4BT9   4BTA   4BTB  

Gene RIF (14)

PMID Text
26966067 Thus, we conclude that miR-30e suppresses proliferation of hepatoma cells through targeting P4HA1 mRNA.
25115393 Studies indicate P4HA1 copy number gain in a subset of metastatic prostate tumors and its expression is also regulated by microRNA-124.
23423382 Hypoxia-inducible factor 1 (HIF-1) promotes extracellular matrix remodeling under hypoxic conditions by inducing P4HA1, P4HA2, and PLOD2 expression in fibroblasts.
23178710 Overexpression of miR-122 markedly attenuated the expression of P4HA1 via targeting a binding site located at 3'-UTR of P4HA1 mRNA
23022409 IL-6 significantly downregulated P4Halpha1 expression in aortic smooth muscle cells
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19890397 analysis of the 2-His-1-Asp active-site motif in prolyl 4-hydroxylase
16885164 HIF-P4H, HIF-1alpha and HIF-2alpha are effective oxygen sensors
16877351 In comparison with healthy cartilage, Osteoarthritis articular chondrocytes exhibit increased in vivo synthesis of collagen prolyl-4-hydroxylase type II, a pivotal enzyme in collagen triple helix formation.
16837461 Results suggest that the alteration of translational efficiency by nucleolin, which occurs through a hypoxia inducible factor independent pathway, is an important step in collagen prolyl 4-hydroxylase-alpha(I) regulation under hypoxia.
More...

AA Sequence

MIWYILIIGILLPQSLAHPGFFTSIGQMTDLIHTEKDLVTSLKDYIKAEEDKLEQIKKWAEKLDRLTSTA      1 - 70
TKDPEGFVGHPVNAFKLMKRLNTEWSELENLVLKDMSDGFISNLTIQRQYFPNDEDQVGAAKALLRLQDT     71 - 140
YNLDTDTISKGNLPGVKHKSFLTAEDCFELGKVAYTEADYYHTELWMEQALRQLDEGEISTIDKVSVLDY    141 - 210
LSYAVYQQGDLDKALLLTKKLLELDPEHQRANGNLKYFEYIMAKEKDVNKSASDDQSDQKTTPKKKGVAV    211 - 280
DYLPERQKYEMLCRGEGIKMTPRRQKKLFCRYHDGNRNPKFILAPAKQEDEWDKPRIIRFHDIISDAEIE    281 - 350
IVKDLAKPRLRRATISNPITGDLETVHYRISKSAWLSGYENPVVSRINMRIQDLTGLDVSTAEELQVANY    351 - 420
GVGGQYEPHFDFARKDEPDAFKELGTGNRIATWLFYMSDVSAGGATVFPEVGASVWPKKGTAVFWYNLFA    421 - 490
SGEGDYSTRHAACPVLVGNKWVSNKWLHERGQEFRRPCTLSELE                              491 - 534
//

Text Mined References (33)

PMID Year Title
26966067 2016 MiR-30e suppresses proliferation of hepatoma cells via targeting prolyl 4-hydroxylase subunit alpha-1 (P4HA1) mRNA.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25115393 2014 The miR-124-prolyl hydroxylase P4HA1-MMP1 axis plays a critical role in prostate cancer progression.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23423382 2013 Hypoxia-inducible factor 1 (HIF-1) promotes extracellular matrix remodeling under hypoxic conditions by inducing P4HA1, P4HA2, and PLOD2 expression in fibroblasts.
23178710 2013 miR-122 regulates collagen production via targeting hepatic stellate cells and suppressing P4HA1 expression.
23022409 2012 Interleukin 6 destabilizes atherosclerotic plaques by downregulating prolyl-4-hydroxylase ?1 via a mitogen-activated protein kinase and c-Jun pathway.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19946888 2010 Defining the membrane proteome of NK cells.
More...