Property Summary

Ligand Count 2
NCBI Gene PubMed Count 31
PubMed Score 17.53
PubTator Score 15.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytoma 1.100 1.1e-02
atypical teratoid / rhabdoid tumor 1.200 1.1e-03
ductal carcinoma in situ 1.200 4.5e-03
ependymoma 1.100 4.1e-02
glioblastoma 1.100 2.4e-04
intraductal papillary-mucinous neoplasm ... 1.300 1.0e-02
Multiple myeloma 1.718 7.6e-03
non-small cell lung cancer 1.077 3.9e-13
osteosarcoma 1.659 1.9e-02
ovarian cancer 2.300 1.1e-04
pancreatic cancer 1.200 2.1e-05
pediatric high grade glioma 1.300 2.4e-04
primary pancreatic ductal adenocarcinoma 1.482 4.8e-02
psoriasis -1.300 4.7e-10

Gene RIF (17)

AA Sequence

MIWYILIIGILLPQSLAHPGFFTSIGQMTDLIHTEKDLVTSLKDYIKAEEDKLEQIKKWAEKLDRLTSTA      1 - 70
TKDPEGFVGHPVNAFKLMKRLNTEWSELENLVLKDMSDGFISNLTIQRQYFPNDEDQVGAAKALLRLQDT     71 - 140
YNLDTDTISKGNLPGVKHKSFLTAEDCFELGKVAYTEADYYHTELWMEQALRQLDEGEISTIDKVSVLDY    141 - 210
LSYAVYQQGDLDKALLLTKKLLELDPEHQRANGNLKYFEYIMAKEKDVNKSASDDQSDQKTTPKKKGVAV    211 - 280
DYLPERQKYEMLCRGEGIKMTPRRQKKLFCRYHDGNRNPKFILAPAKQEDEWDKPRIIRFHDIISDAEIE    281 - 350
IVKDLAKPRLRRATISNPITGDLETVHYRISKSAWLSGYENPVVSRINMRIQDLTGLDVSTAEELQVANY    351 - 420
GVGGQYEPHFDFARKDEPDAFKELGTGNRIATWLFYMSDVSAGGATVFPEVGASVWPKKGTAVFWYNLFA    421 - 490
SGEGDYSTRHAACPVLVGNKWVSNKWLHERGQEFRRPCTLSELE                              491 - 534
//

Text Mined References (36)

PMID Year Title