Property Summary

NCBI Gene PubMed Count 43
PubMed Score 34.99
PubTator Score 1125.86

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P13671
Symbols

Gene

C6

PDB

4A5W   4E0S   3T5O  

Gene RIF (18)

PMID Text
25735751 Complement C5b-9 complex sensitizes 661W photoreceptor cells to both apoptosis and necroptosis.
22500023 Crystal structure of C5b-6 suggests structural basis for priming assembly of the membrane attack complex.
22288589 finding of very high serious morbidity in patients with complete C6 deficiency due to meningococcal infections
22267737 Structure of complement C6 suggests a mechanism for initiation and unidirectional, sequential assembly of membrane attack complex (MAC).
21704099 Genetic polymorphisms in C6 gene do not influence the risk of aspirin hypersensitivity in Korean asthmatic patients.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20459687 Observational study of gene-disease association. (HuGE Navigator)
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MARRSVLYFILLNALINKGQACFCDHYAWTQWTSCSKTCNSGTQSRHRQIVVDKYYQENFCEQICSKQET      1 - 70
RECNWQRCPINCLLGDFGPWSDCDPCIEKQSKVRSVLRPSQFGGQPCTAPLVAFQPCIPSKLCKIEEADC     71 - 140
KNKFRCDSGRCIARKLECNGENDCGDNSDERDCGRTKAVCTRKYNPIPSVQLMGNGFHFLAGEPRGEVLD    141 - 210
NSFTGGICKTVKSSRTSNPYRVPANLENVGFEVQTAEDDLKTDFYKDLTSLGHNENQQGSFSSQGGSSFS    211 - 280
VPIFYSSKRSENINHNSAFKQAIQASHKKDSSFIRIHKVMKVLNFTTKAKDLHLSDVFLKALNHLPLEYN    281 - 350
SALYSRIFDDFGTHYFTSGSLGGVYDLLYQFSSEELKNSGLTEEEAKHCVRIETKKRVLFAKKTKVEHRC    351 - 420
TTNKLSEKHEGSFIQGAEKSISLIRGGRSEYGAALAWEKGSSGLEEKTFSEWLESVKENPAVIDFELAPI    421 - 490
VDLVRNIPCAVTKRNNLRKALQEYAAKFDPCQCAPCPNNGRPTLSGTECLCVCQSGTYGENCEKQSPDYK    491 - 560
SNAVDGQWGCWSSWSTCDATYKRSRTRECNNPAPQRGGKRCEGEKRQEEDCTFSIMENNGQPCINDDEEM    561 - 630
KEVDLPEIEADSGCPQPVPPENGFIRNEKQLYLVGEDVEISCLTGFETVGYQYFRCLPDGTWRQGDVECQ    631 - 700
RTECIKPVVQEVLTITPFQRLYRIGESIELTCPKGFVVAGPSRYTCQGNSWTPPISNSLTCEKDTLTKLK    701 - 770
GHCQLGQKQSGSECICMSPEEDCSHHSEDLCVFDTDSNDYFTSPACKFLAEKCLNNQQLHFLHIGSCQDG    771 - 840
RQLEWGLERTRLSSNSTKKESCGYDTCYDWEKCSASTSKCVCLLPPQCFKGGNQLYCVKMGSSTSEKTLN    841 - 910
ICEVGTIRCANRKMEILHPGKCLA                                                  911 - 934
//

Text Mined References (46)

PMID Year Title
25735751 2015 Exposure to the complement C5b-9 complex sensitizes 661W photoreceptor cells to both apoptosis and necroptosis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23149075 2013 Preliminary evidence of genetic determinants of adiponectin response to fenofibrate in the Genetics of Lipid Lowering Drugs and Diet Network.
22500023 2012 Crystal structure of C5b-6 suggests structural basis for priming assembly of the membrane attack complex.
22288589 2012 Complete deficiency of the sixth complement component (C6Q0), susceptibility to Neisseria meningitidis infections and analysis of the frequencies of C6Q0 gene defects in South Africans.
22267737 2012 Structure of complement C6 suggests a mechanism for initiation and unidirectional, sequential assembly of membrane attack complex (MAC).
21704099 2011 Association analysis of C6 genetic variations and aspirin hypersensitivity in Korean asthmatic patients.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20459687 2010 Candidate malaria susceptibility/protective SNPs in hospital and population-based studies: the effect of sub-structuring.
More...