Property Summary

NCBI Gene PubMed Count 27
Grant Count 10
R01 Count 6
Funding $424,542.2
PubMed Score 41.63
PubTator Score 30.01

Knowledge Summary

Patent

No data available

Expression

Gene RIF (15)

PMID Text
24599957 the faster migrating Tg adduct C primarily engages the CaBP1/P5 oxidoreductase, whereas the slower migrating Tg adduct A primarily engages ERp72.
24464223 CDDP-resistant non-small lung cancer cells undergo profound remodeling of their endoplasmic reticulum (ER) proteome (>80 proteins identified by proteomics) and exhibit a dramatic overexpression of two protein disulfide isomerases, PDIA4 and PDIA6.
23206338 PDI is predominantly involved in HIV-1 entry and infection of the T cell line PM-1 and PHA-stimulated primary T lymphocytes, suggesting the preferential use of PDI relevant to the HIV-1 entry and establishment of virus reservoirs in resting CD4+ cells
22230366 PDI is predominantly involved in HIV-1 entry and infection of the T cell line PM-1 and PHA-stimulated primary T lymphocytes, suggesting the preferential use of PDI relevant to the HIV-1 entry and establishment of virus reservoirs in resting CD4+ cells
22190034 PDI is predominantly involved in HIV-1 entry and infection of the T cell line PM-1 and PHA-stimulated primary T lymphocytes, suggesting the preferential use of PDI relevant to the HIV-1 entry and establishment of virus reservoirs in resting CD4+ cells
22190034 PDI is predominantly involved in HIV-1 entry and infection of the T cell line PM-1 and PHA-stimulated primary T lymphocytes, suggesting the preferential use of PDI relevant to the HIV-1 entry and establishment of virus reservoirs in resting CD4+ cells
21743296 novel esophageal squamous cell carcinoma marker PDIA4 was identified by mass spectrometry and immunohistochemical analysis
20458450 PDI is predominantly involved in HIV-1 entry and infection of the T cell line PM-1 and PHA-stimulated primary T lymphocytes, suggesting the preferential use of PDI relevant to the HIV-1 entry and establishment of virus reservoirs in resting CD4+ cells
19834535 Observational study of gene-disease association. (HuGE Navigator)
18620548 Nox1 associates with ERp72, which involves its N-terminus encompassing a Ca(2+)-binding site and the first TRX-like motif.
More...

AA Sequence

MRPRKAFLLLLLLGLVQLLAVAGAEGPDEDSSNRENAIEDEEEEEEEDDDEEEDDLEVKEENGVLVLNDA      1 - 70
NFDNFVADKDTVLLEFYAPWCGHCKQFAPEYEKIANILKDKDPPIPVAKIDATSASVLASRFDVSGYPTI     71 - 140
KILKKGQAVDYEGSRTQEEIVAKVREVSQPDWTPPPEVTLVLTKENFDEVVNDADIILVEFYAPWCGHCK    141 - 210
KLAPEYEKAAKELSKRSPPIPLAKVDATAETDLAKRFDVSGYPTLKIFRKGRPYDYNGPREKYGIVDYMI    211 - 280
EQSGPPSKEILTLKQVQEFLKDGDDVIIIGVFKGESDPAYQQYQDAANNLREDYKFHHTFSTEIAKFLKV    281 - 350
SQGQLVVMQPEKFQSKYEPRSHMMDVQGSTQDSAIKDFVLKYALPLVGHRKVSNDAKRYTRRPLVVVYYS    351 - 420
VDFSFDYRAATQFWRSKVLEVAKDFPEYTFAIADEEDYAGEVKDLGLSESGEDVNAAILDESGKKFAMEP    421 - 490
EEFDSDTLREFVTAFKKGKLKPVIKSQPVPKNNKGPVKVVVGKTFDSIVMDPKKDVLIEFYAPWCGHCKQ    491 - 560
LEPVYNSLAKKYKGQKGLVIAKMDATANDVPSDRYKVEGFPTIYFAPSGDKKNPVKFEGGDRDLEHLSKF    561 - 630
IEEHATKLSRTKEEL                                                           631 - 645
//

Text Mined References (33)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24599957 2014 Transient covalent interactions of newly synthesized thyroglobulin with oxidoreductases of the endoplasmic reticulum.
24464223 2014 The protein disulfide isomerases PDIA4 and PDIA6 mediate resistance to cisplatin-induced cell death in lung adenocarcinoma.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22665516 2012 An interaction map of endoplasmic reticulum chaperones and foldases.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22190034 2011 Global landscape of HIV-human protein complexes.
21743296 2011 Quantitative tissue proteomics of esophageal squamous cell carcinoma for novel biomarker discovery.
21269460 2011 Initial characterization of the human central proteome.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
More...