Property Summary

NCBI Gene PubMed Count 42
Grant Count 3
R01 Count 3
Funding $258,020.01
PubMed Score 161.67
PubTator Score 241.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
esophageal adenocarcinoma -5.100 0.023
osteosarcoma -1.962 0.000
non-small cell lung cancer 3.390 0.000
lung cancer -3.000 0.047
interstitial cystitis -4.900 0.003
cystic fibrosis 1.300 0.033
nasopharyngeal carcinoma -3.200 0.005
spina bifida -1.253 0.046

Synonym

Accession P13646 Q53G54 Q6AZK5 Q8N240
Symbols K13
CK13
WSN2

Gene

Gene RIF (17)

PMID Text
26225699 Loss of CK13 expression is associated with invasive oral squamous cell carcinoma.
25851906 Decreased KRT13 was associated with Esophageal Squamous Cell Carcinoma.
25735388 Low KRT13 mRNA expression is associated with oral squamous cell carcinoma.
25527207 Our data provide mechanistic insights into the epigenetic silencing of KRT13 genes in OSCC cells and might be useful for the development of diagnostic markers and novel therapeutic approaches against OSCCs.
25076852 The immunofluorescent staining pattern of Wnt1 and CK7 as well as Wnt1 and CK13 was consistent with IHC results. Thus, in pleomorphic adenoma, Wnt is involved in tumor cell differentiation of peripheral columnar cells forming solid nests
24471966 keratin14 expression can be used to detect early epithelial dysplasia, and that keratin13 and keratin17 expression are useful for detecting neoplastic changes
24247036 Immunoexpression of CK13 and CK17 in light green-stained superficial cells was associated with more severe morphological atypia in tongue squamous cell carcinoma
23757496 Fluorescent keratin 13 integrates into the endogenous keratin cytoskeleton in human vulva carcinoma-derived A431 cells, thereby serving as a reliable marker of keratin dynamics.
22301701 Loss of K13 in oral carcinoma in situ is partly due to its gene repression, but may also be due to some unknown post-translational events.
21738394 Keratin 13 is a more specific marker of conjunctival epithelium than keratin 19.
More...

AA Sequence

MSLRLQSSSASYGGGFGGGSCQLGGGRGVSTCSTRFVSGGSAGGYGGGVSCGFGGGAGSGFGGGYGGGLG      1 - 70
GGYGGGLGGGFGGGFAGGFVDFGACDGGLLTGNEKITMQNLNDRLASYLEKVRALEEANADLEVKIRDWH     71 - 140
LKQSPASPERDYSPYYKTIEELRDKILTATIENNRVILEIDNARLAADDFRLKYENELALRQSVEADING    141 - 210
LRRVLDELTLSKTDLEMQIESLNEELAYMKKNHEEEMKEFSNQVVGQVNVEMDATPGIDLTRVLAEMREQ    211 - 280
YEAMAERNRRDAEEWFHTKSAELNKEVSTNTAMIQTSKTEITELRRTLQGLEIELQSQLSMKAGLENTVA    281 - 350
ETECRYALQLQQIQGLISSIEAQLSELRSEMECQNQEYKMLLDIKTRLEQEIATYRSLLEGQDAKMIGFP    351 - 420
SSAGSVSPRSTSVTTTSSASVTTTSNASGRRTSDVRRP                                    421 - 458
//

Text Mined References (51)

PMID Year Title
26225699 2015 Differential Expression of Cytokeratin 13 in Non-Neoplastic, Dysplastic and Neoplastic Oral Mucosa in a High Risk Pakistani Population.
25851906 2015 Krüppel-like Factor 4 Promotes Esophageal Squamous Cell Carcinoma Differentiation by Up-regulating Keratin 13 Expression.
25735388 2015 KRT13, FAIM2 and CYP2W1 mRNA expression in oral squamous cell carcinoma patients with risk habits.
25527207 2014 Epigenetic alterations of the keratin 13 gene in oral squamous cell carcinoma.
25076852 2014 Wnt signaling as a possible promoting factor of cell differentiation in pleomorphic adenomas.
24471966 2014 Immunohistochemical staining patterns of cytokeratins 13, 14, and 17 in oral epithelial dysplasia including orthokeratotic dysplasia.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24247036 2014 Evaluation of superficial oral squamous cell malignancy based on morphometry and immunoexpression of cytokeratin 13 and cytokeratin 17.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23757496 2013 Measuring the regulation of keratin filament network dynamics.
More...