Property Summary

NCBI Gene PubMed Count 46
PubMed Score 171.16
PubTator Score 241.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
cystic fibrosis 1.300 3.3e-02
cystic fibrosis and chronic rhinosinusit... 1.254 1.2e-02
esophageal adenocarcinoma -5.100 2.3e-02
interstitial cystitis -4.900 2.7e-03
lung cancer -3.000 4.7e-02
nasopharyngeal carcinoma -3.200 5.0e-03
non-small cell lung cancer 3.390 4.3e-08
osteosarcoma -1.962 1.4e-05
spina bifida -1.253 4.6e-02

Gene RIF (19)

AA Sequence

MSLRLQSSSASYGGGFGGGSCQLGGGRGVSTCSTRFVSGGSAGGYGGGVSCGFGGGAGSGFGGGYGGGLG      1 - 70
GGYGGGLGGGFGGGFAGGFVDFGACDGGLLTGNEKITMQNLNDRLASYLEKVRALEEANADLEVKIRDWH     71 - 140
LKQSPASPERDYSPYYKTIEELRDKILTATIENNRVILEIDNARLAADDFRLKYENELALRQSVEADING    141 - 210
LRRVLDELTLSKTDLEMQIESLNEELAYMKKNHEEEMKEFSNQVVGQVNVEMDATPGIDLTRVLAEMREQ    211 - 280
YEAMAERNRRDAEEWFHTKSAELNKEVSTNTAMIQTSKTEITELRRTLQGLEIELQSQLSMKAGLENTVA    281 - 350
ETECRYALQLQQIQGLISSIEAQLSELRSEMECQNQEYKMLLDIKTRLEQEIATYRSLLEGQDAKMIGFP    351 - 420
SSAGSVSPRSTSVTTTSSASVTTTSNASGRRTSDVRRP                                    421 - 458
//

Text Mined References (55)

PMID Year Title