Property Summary

NCBI Gene PubMed Count 73
Grant Count 25
R01 Count 22
Funding $4,051,222.12
PubMed Score 621.74
PubTator Score 649.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma 1.299 0.001
glioblastoma 1.300 0.001
periodontitis -1.100 0.000
Breast cancer 2.200 0.039
cystic fibrosis -1.600 0.000
ovarian cancer 1.500 0.002

Gene RIF (30)

PMID Text
26181054 Complete structure of an epithelial keratin 1/keratin 10 dimer has been presented.
26176760 findings provide structural insights into phenotypic variation in epidermolytic ichthyosis due to KRT10 mutations
26125866 recombinant adenovirus-mediated overexpression of KRT10 and PTEN may improve the cisplatin resistance of ovarian cancer in vitro and in vivo
25210931 We present the spectrum of clinical variability of ichthyosis with confetti in 6 patients with confirmed mutations in KRT10.
24626314 The diagnosis of ichthyosis with confetti was confirmed by the identification of 2 previously unreported mutations in intron 6 and exon 7 of KRT10.
24434152 Data indicate that KRT10 is a downstream molecule of PTEN which improves cisplatin-resistance of ovarian cancer cells.
24096702 Case Report: extensive postzygotic mosaicism for a novel keratin 10 mutation in epidermolytic ichthyosis.
23182068 Among Japanese patients with bullous congenital ichthyosiform erythroderma for which genetic diagnosis was determined, all showed mustations in KRT1 or KRT10.
23121977 Molecular mimicry between HSP 65 of Mycobacterium leprae and cytokeratin 10 of the host keratin play the role in pathogenesis of leprosy.
22734720 Most of the orthokeratotic dysplasia constituent cells were immunopositive for keratin 10, but not for keratins 13, 17 or 19.
More...

AA Sequence

MSVRYSSSKHYSSSRSGGGGGGGGCGGGGGVSSLRISSSKGSLGGGFSSGGFSGGSFSRGSSGGGCFGGS      1 - 70
SGGYGGLGGFGGGSFRGSYGSSSFGGSYGGIFGGGSFGGGSFGGGSFGGGGFGGGGFGGGFGGGFGGDGG     71 - 140
LLSGNEKVTMQNLNDRLASYLDKVRALEESNYELEGKIKEWYEKHGNSHQGEPRDYSKYYKTIDDLKNQI    141 - 210
LNLTTDNANILLQIDNARLAADDFRLKYENEVALRQSVEADINGLRRVLDELTLTKADLEMQIESLTEEL    211 - 280
AYLKKNHEEEMKDLRNVSTGDVNVEMNAAPGVDLTQLLNNMRSQYEQLAEQNRKDAEAWFNEKSKELTTE    281 - 350
IDNNIEQISSYKSEITELRRNVQALEIELQSQLALKQSLEASLAETEGRYCVQLSQIQAQISALEEQLQQ    351 - 420
IRAETECQNTEYQQLLDIKIRLENEIQTYRSLLEGEGSSGGGGRGGGSFGGGYGGGSSGGGSSGGGHGGG    421 - 490
HGGSSGGGYGGGSSGGGSSGGGYGGGSSSGGHGGSSSGGYGGGSSGGGGGGYGGGSSGGGSSSGGGYGGG    491 - 560
SSSGGHKSSSSGSVGESSSKGPRY                                                  561 - 584
//

Text Mined References (79)

PMID Year Title
26181054 2015 Complete Structure of an Epithelial Keratin Dimer: Implications for Intermediate Filament Assembly.
26176760 2015 Mutations Affecting Keratin 10 Surface-Exposed Residues Highlight the Structural Basis of Phenotypic Variation in Epidermolytic Ichthyosis.
26125866 2015 Recombinant adenovirus-mediated overexpression of PTEN and KRT10 improves cisplatin resistance of ovarian cancer in vitro and in vivo.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25210931 2015 The phenotypic and genotypic spectra of ichthyosis with confetti plus novel genetic variation in the 3' end of KRT10: from disease to a syndrome.
24626314 2014 Early immunopathological diagnosis of ichthyosis with confetti in two sporadic cases with new mutations in keratin 10.
24434152 2014 PTEN overexpression improves cisplatin-resistance of human ovarian cancer cells through upregulating KRT10 expression.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24096702 2014 Extensive postzygotic mosaicism for a novel keratin 10 mutation in epidermolytic ichthyosis.
23580065 2013 Shotgun proteomics reveals specific modulated protein patterns in tears of patients with primary open angle glaucoma naïve to therapy.
More...