Property Summary

NCBI Gene PubMed Count 79
PubMed Score 654.88
PubTator Score 649.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Breast cancer 2.200 3.9e-02
cystic fibrosis -1.400 9.5e-03
glioblastoma 1.300 1.3e-03
osteosarcoma 1.048 3.2e-02
ovarian cancer -1.300 2.6e-04
periodontitis -1.100 1.5e-14

Gene RIF (35)

AA Sequence

MSVRYSSSKHYSSSRSGGGGGGGGCGGGGGVSSLRISSSKGSLGGGFSSGGFSGGSFSRGSSGGGCFGGS      1 - 70
SGGYGGLGGFGGGSFRGSYGSSSFGGSYGGIFGGGSFGGGSFGGGSFGGGGFGGGGFGGGFGGGFGGDGG     71 - 140
LLSGNEKVTMQNLNDRLASYLDKVRALEESNYELEGKIKEWYEKHGNSHQGEPRDYSKYYKTIDDLKNQI    141 - 210
LNLTTDNANILLQIDNARLAADDFRLKYENEVALRQSVEADINGLRRVLDELTLTKADLEMQIESLTEEL    211 - 280
AYLKKNHEEEMKDLRNVSTGDVNVEMNAAPGVDLTQLLNNMRSQYEQLAEQNRKDAEAWFNEKSKELTTE    281 - 350
IDNNIEQISSYKSEITELRRNVQALEIELQSQLALKQSLEASLAETEGRYCVQLSQIQAQISALEEQLQQ    351 - 420
IRAETECQNTEYQQLLDIKIRLENEIQTYRSLLEGEGSSGGGGRGGGSFGGGYGGGSSGGGSSGGGHGGG    421 - 490
HGGSSGGGYGGGSSGGGSSGGGYGGGSSSGGHGGSSSGGYGGGSSGGGGGGYGGGSSGGGSSSGGGYGGG    491 - 560
SSSGGHKSSSSGSVGESSSKGPRY                                                  561 - 584
//

Text Mined References (85)

PMID Year Title