Property Summary

NCBI Gene PubMed Count 35
PubMed Score 21.87
PubTator Score 45.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Esophageal Neoplasms 67
Disease Target Count P-value
non-small cell lung cancer 2798 3.351467679337E-12
acute quadriplegic myopathy 1157 8.27302384697615E-9
ulcerative colitis 2087 5.48571171881434E-8
malignant mesothelioma 3163 2.50373214598421E-7
osteosarcoma 7933 1.07472178555781E-6
lung cancer 4473 3.9128448869117E-6
atypical teratoid/rhabdoid tumor 1095 1.03942364834719E-5
colon cancer 1475 1.83871146157974E-5
group 3 medulloblastoma 2254 5.66427350575962E-5
lung adenocarcinoma 2714 1.07899398917543E-4
ovarian cancer 8492 1.7521180445308E-4
cystic fibrosis 1670 2.85670982036395E-4
medulloblastoma, large-cell 6234 9.76168514358711E-4
psoriasis 6685 0.00127892031404595
adrenocortical carcinoma 1427 0.00202125081435137
nephrosclerosis 329 0.00231423531995248
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00372693530145527
pancreatic cancer 2300 0.00922848753419513
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00946196571032029
primary pancreatic ductal adenocarcinoma 1271 0.0124523185348882
Endometriosis 535 0.0137898272283841
active Crohn's disease 918 0.0264232235547177
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0270273614960762
Disease Target Count Z-score Confidence
Cancer 2346 3.088 1.5

Expression

Synonym

Accession P13640 P80296 MT-1G
Symbols MT1
MT1K

Gene

  Ortholog (1)

Species Source
Chimp OMA EggNOG

Gene RIF (18)

PMID Text
25072246 PU.1 suppressive target gene, metallothionein 1G, inhibits retinoic acid-induced NB4 cell differentiation
24782625 MT1M and MT1G promoter methylation may be used as serum biomarkers for noninvasive detection of hepatocellular carcinoma.
24662736 MT1G was down-regulated in renal cell carcinogenesis.
24634414 Metallothionein 1G and zinc sensitize human colorectal cancer cells to chemotherapy.
24098937 Metallothionein 1G functions as a tumor suppressor in thyroid cancer through modulating the PI3K/Akt signaling pathway.
23902976 GPR56, MT1G, and RASSF1 might be the potential methylation markers associated with acquired multidrug resistance of lung adenocarcinoma.
20812968 MT-1A, -1F, -1G, -1X and -2A isoforms are significantly down-regulated in proliferating keloid fibroblasts.
20551211 Increases in MT gene expression and intracellular zinc levels may contribute directly to maintenance of an immune-activated monocyte by mediating an increased resistance to apoptosis during active HIV-1 viremia.
20032811 Results describe MT1G promoter hypermethylation in hepatoblastoma and demonstrate that aberrant methylation is a frequent event in this malignancy.
19639168 MT1G acts as a tumor suppressor gene in hepatocellular carcinoma
More...

AA Sequence

MDPNCSCAAAGVSCTCASSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASEKCSCCA              1 - 62
//

Text Mined References (35)

PMID Year Title
25072246 2014 A PU.1 suppressive target gene, metallothionein 1G, inhibits retinoic acid-induced NB4 cell differentiation.
24782625 2014 MT1M and MT1G promoter methylation as biomarkers for hepatocellular carcinoma.
24662736 2015 An epigenetic screen unmasks metallothioneins as putative contributors to renal cell carcinogenesis.
24634414 2014 Metallothionein 1G and zinc sensitize human colorectal cancer cells to chemotherapy.
24098937 2013 Metallothionein 1G functions as a tumor suppressor in thyroid cancer through modulating the PI3K/Akt signaling pathway.
23902976 2013 Promoter methylation profiles between human lung adenocarcinoma multidrug resistant A549/cisplatin (A549/DDP) cells and its progenitor A549 cells.
22780124 2013 Genome-wide association study of a quantitative disordered gambling trait.
20812968 2010 Modulation of metallothionein isoforms is associated with collagen deposition in proliferating keloid fibroblasts in vitro.
20551211 2010 Increased metallothionein gene expression, zinc, and zinc-dependent resistance to apoptosis in circulating monocytes during HIV viremia.
20032811 2010 MT1G hypermethylation: a potential prognostic marker for hepatoblastoma.
More...