Property Summary

NCBI Gene PubMed Count 35
Grant Count 7
R01 Count 7
Funding $352,522.8
PubMed Score 21.87
PubTator Score 45.53

Knowledge Summary

Patent

No data available

Expression

Gene RIF (18)

PMID Text
25072246 PU.1 suppressive target gene, metallothionein 1G, inhibits retinoic acid-induced NB4 cell differentiation
24782625 MT1M and MT1G promoter methylation may be used as serum biomarkers for noninvasive detection of hepatocellular carcinoma.
24662736 MT1G was down-regulated in renal cell carcinogenesis.
24634414 Metallothionein 1G and zinc sensitize human colorectal cancer cells to chemotherapy.
24098937 Metallothionein 1G functions as a tumor suppressor in thyroid cancer through modulating the PI3K/Akt signaling pathway.
23902976 GPR56, MT1G, and RASSF1 might be the potential methylation markers associated with acquired multidrug resistance of lung adenocarcinoma.
20812968 MT-1A, -1F, -1G, -1X and -2A isoforms are significantly down-regulated in proliferating keloid fibroblasts.
20551211 Increases in MT gene expression and intracellular zinc levels may contribute directly to maintenance of an immune-activated monocyte by mediating an increased resistance to apoptosis during active HIV-1 viremia.
20032811 Results describe MT1G promoter hypermethylation in hepatoblastoma and demonstrate that aberrant methylation is a frequent event in this malignancy.
19639168 MT1G acts as a tumor suppressor gene in hepatocellular carcinoma
More...

AA Sequence

MDPNCSCAAAGVSCTCASSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASEKCSCCA              1 - 62
//

Text Mined References (35)

PMID Year Title
25072246 2014 A PU.1 suppressive target gene, metallothionein 1G, inhibits retinoic acid-induced NB4 cell differentiation.
24782625 2014 MT1M and MT1G promoter methylation as biomarkers for hepatocellular carcinoma.
24662736 2015 An epigenetic screen unmasks metallothioneins as putative contributors to renal cell carcinogenesis.
24634414 2014 Metallothionein 1G and zinc sensitize human colorectal cancer cells to chemotherapy.
24098937 2013 Metallothionein 1G functions as a tumor suppressor in thyroid cancer through modulating the PI3K/Akt signaling pathway.
23902976 2013 Promoter methylation profiles between human lung adenocarcinoma multidrug resistant A549/cisplatin (A549/DDP) cells and its progenitor A549 cells.
22780124 2013 Genome-wide association study of a quantitative disordered gambling trait.
20812968 2010 Modulation of metallothionein isoforms is associated with collagen deposition in proliferating keloid fibroblasts in vitro.
20551211 2010 Increased metallothionein gene expression, zinc, and zinc-dependent resistance to apoptosis in circulating monocytes during HIV viremia.
20032811 2010 MT1G hypermethylation: a potential prognostic marker for hepatoblastoma.
More...