Property Summary

NCBI Gene PubMed Count 37
PubMed Score 23.76
PubTator Score 45.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
active Crohn's disease -1.249 2.6e-02
acute quadriplegic myopathy 1.263 8.3e-09
adrenocortical carcinoma -1.186 2.0e-03
atypical teratoid / rhabdoid tumor -1.400 1.4e-03
colon cancer -2.100 1.8e-05
cystic fibrosis 1.128 2.9e-04
Endometriosis -2.839 1.4e-02
group 3 medulloblastoma -2.300 5.7e-05
intraductal papillary-mucinous adenoma (... -2.200 9.5e-03
intraductal papillary-mucinous carcinoma... -2.600 2.7e-02
intraductal papillary-mucinous neoplasm ... -3.800 3.7e-03
lung adenocarcinoma -1.300 1.1e-04
lung cancer -1.600 1.3e-04
malignant mesothelioma -1.700 2.5e-07
medulloblastoma, large-cell -2.000 9.8e-04
nephrosclerosis -1.130 2.3e-03
non-small cell lung cancer -1.741 3.4e-12
osteosarcoma 1.923 1.1e-06
ovarian cancer 1.800 1.8e-04
pancreatic cancer -1.500 2.4e-05
primary pancreatic ductal adenocarcinoma -2.075 1.2e-02
psoriasis -1.100 1.3e-03
ulcerative colitis -2.500 5.5e-08

Gene RIF (20)

AA Sequence

MDPNCSCAAAGVSCTCASSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASEKCSCCA              1 - 62
//

Text Mined References (37)

PMID Year Title