Property Summary

NCBI Gene PubMed Count 64
PubMed Score 938.38
PubTator Score 322.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
dermatomyositis -1.100 1.2e-03
ependymoma 1.800 1.3e-02
intraductal papillary-mucinous neoplasm ... -1.300 2.4e-03
lung cancer 1.400 2.0e-04
Multiple myeloma 1.222 1.1e-02
oligodendroglioma 1.800 4.6e-03
ovarian cancer -1.500 1.9e-06
Waldenstrons macroglobulinemia 1.151 5.4e-03

Gene RIF (32)

AA Sequence

MVNFTVDQIRAIMDKKANIRNMSVIAHVDHGKSTLTDSLVCKAGIIASARAGETRFTDTRKDEQERCITI      1 - 70
KSTAISLFYELSENDLNFIKQSKDGAGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTE     71 - 140
TVLRQAIAERIKPVLMMNKMDRALLELQLEPEELYQTFQRIVENVNVIISTYGEGESGPMGNIMIDPVLG    141 - 210
TVGFGSGLHGWAFTLKQFAEMYVAKFAAKGEGQLGPAERAKKVEDMMKKLWGDRYFDPANGKFSKSATSP    211 - 280
EGKKLPRTFCQLILDPIFKVFDAIMNFKKEETAKLIEKLDIKLDSEDKDKEGKPLLKAVMRRWLPAGDAL    281 - 350
LQMITIHLPSPVTAQKYRCELLYEGPPDDEAAMGIKSCDPKGPLMMYISKMVPTSDKGRFYAFGRVFSGL    351 - 420
VSTGLKVRIMGPNYTPGKKEDLYLKPIQRTILMMGRYVEPIEDVPCGNIVGLVGVDQFLVKTGTITTFEH    421 - 490
AHNMRVMKFSVSPVVRVAVEAKNPADLPKLVEGLKRLAKSDPMVQCIIEESGEHIIAGAGELHLEICLKD    491 - 560
LEEDHACIPIKKSDPVVSYRETVSEESNVLCLSKSPNKHNRLYMKARPFPDGLAEDIDKGEVSARQELKQ    561 - 630
RARYLAEKYEWDVAEARKIWCFGPDGTGPNILTDITKGVQYLNEIKDSVVAGFQWATKEGALCEENMRGV    631 - 700
RFDVHDVTLHADAIHRGGGQIIPTARRCLYASVLTAQPRLMEPIYLVEIQCPEQVVGGIYGVLNRKRGHV    701 - 770
FEESQVAGTPMFVVKAYLPVNESFGFTADLRSNTGGQAFPQCVFDHWQILPGDPFDNSSRPSQVVAETRK    771 - 840
RKGLKEGIPALDNFLDKL                                                        841 - 858
//

Text Mined References (77)

PMID Year Title