Property Summary

Ligand Count 3
NCBI Gene PubMed Count 75
PubMed Score 169.97
PubTator Score 104.94

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.1
Skin cancer 469 0.0 0.5
Disease Target Count Z-score Confidence
Parkinson's disease 392 0.0 4.0

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -2.000 2.4e-03
astrocytoma -2.000 6.0e-15
Astrocytoma, Pilocytic -3.200 1.7e-08
atypical teratoid / rhabdoid tumor -2.300 1.3e-04
ependymoma -3.800 3.5e-21
glioblastoma -2.300 5.4e-05
group 4 medulloblastoma 1.600 1.1e-02
lung carcinoma 2.400 3.9e-49
medulloblastoma, large-cell 1.100 1.2e-04
oligodendroglioma -2.100 1.2e-15
Pick disease -2.300 1.7e-02
pituitary cancer 2.700 1.9e-06
subependymal giant cell astrocytoma -3.377 2.5e-02

 CSPA Cell Line (2)

Gene RIF (49)

AA Sequence

MGDKKDDKDSPKKNKGKERRDLDDLKKEVAMTEHKMSVEEVCRKYNTDCVQGLTHSKAQEILARDGPNAL      1 - 70
TPPPTTPEWVKFCRQLFGGFSILLWIGAILCFLAYGIQAGTEDDPSGDNLYLGIVLAAVVIITGCFSYYQ     71 - 140
EAKSSKIMESFKNMVPQQALVIREGEKMQVNAEEVVVGDLVEIKGGDRVPADLRIISAHGCKVDNSSLTG    141 - 210
ESEPQTRSPDCTHDNPLETRNITFFSTNCVEGTARGVVVATGDRTVMGRIATLASGLEVGKTPIAIEIEH    211 - 280
FIQLITGVAVFLGVSFFILSLILGYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKN    281 - 350
LEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGTSFDKSSHTWVALSHIAGLCNR    351 - 420
AVFKGGQDNIPVLKRDVAGDASESALLKCIELSSGSVKLMRERNKKVAEIPFNSTNKYQLSIHETEDPND    421 - 490
NRYLLVMKGAPERILDRCSTILLQGKEQPLDEEMKEAFQNAYLELGGLGERVLGFCHYYLPEEQFPKGFA    491 - 560
FDCDDVNFTTDNLCFVGLMSMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNET    561 - 630
VEDIAARLNIPVSQVNPRDAKACVIHGTDLKDFTSEQIDEILQNHTEIVFARTSPQQKLIIVEGCQRQGA    631 - 700
IVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTL    701 - 770
TSNIPEITPFLLFIMANIPLPLGTITILCIDLGTDMVPAISLAYEAAESDIMKRQPRNPRTDKLVNERLI    771 - 840
SMAYGQIGMIQALGGFFSYFVILAENGFLPGNLVGIRLNWDDRTVNDLEDSYGQQWTYEQRKVVEFTCHT    841 - 910
AFFVSIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMDVALRMYPLKPSWWFC    911 - 980
AFPYSFLIFVYDEIRKLILRRNPGGWVEKETYY                                         981 - 1013
//

Text Mined References (77)

PMID Year Title