Property Summary

NCBI Gene PubMed Count 69
Grant Count 25
R01 Count 18
Funding $1,652,896.21
PubMed Score 117.21
PubTator Score 165.98

Knowledge Summary

Patent (8,249)

Expression

  Differential Expression (7)

Disease log2 FC p
malignant mesothelioma -1.800 0.000
esophageal adenocarcinoma -1.200 0.021
cutaneous lupus erythematosus -1.200 0.008
osteosarcoma 1.846 0.000
atypical teratoid / rhabdoid tumor 1.300 0.001
glioblastoma 1.300 0.001
medulloblastoma, large-cell 1.200 0.000

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
2277 screening 14 / 0 / 0 Center Based Initiative to identify novel modulators of the Retinoic acid receptor-related Orphan Receptors (ROR): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors.
504934 other 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify inverse agonists of the liver receptor homolog-1 (LRH-1; NR5A2): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors

Gene RIF (40)

PMID Text
26237429 A nonsynonymous variant in RARG is highly associated with anthracycline-induced cardiotoxicity in childhood cancers.
25510432 deregulation of the retinoid/rexinoid signaling pathway has a major role and may represent a potential therapeutic target for NUP98-RARG-mediated transformation
24050824 The current status of knowledge indicates that there might be inter- or overlapping actions between PPARg and RARs, and there might be an association of PPARg/RARs(RARa, RARb, and RARg) with renal diseases
23798555 RARG plays an important role in the proliferation, metastasis, and chemoresistance of cholangiocarcinoma through simultaneous activation of the Akt/NF-kappaB and Wnt/beta-catenin pathways.
23518499 RARgamma in concert with ATRA regulates protein levels of CDK1 and its subcellular localization.
22901127 Low RARgamma expression is associated with advanced gastric cancer.
22362749 Evidence that the retinoic acid receptor gamma plays a major role in the regulation of the human prostatic transglutaminase gene.
21990348 findings demonstrate that signaling through RARs has critical roles in molecular reprogramming and that the synergistic interaction between Rarg and Lrh1 directs reprogramming toward ground-state pluripotency
21923909 HIV-1 Nef induces loss of F-actin assembly and inhibits retinoid receptor-mediated transcription
21401418 results suggest that a RARgamma-dependent functional crosstalk is present between the retinoic acid and BMP2 signaling to induce osteogenic transdifferentiation in myoblastic C2C12 cells
More...

AA Sequence

MATNKERLFAAGALGPGSGYPGAGFPFAFPGALRGSPPFEMLSPSFRGLGQPDLPKEMASLSVETQSTSS      1 - 70
EEMVPSSPSPPPPPRVYKPCFVCNDKSSGYHYGVSSCEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRN     71 - 140
RCQYCRLQKCFEVGMSKEAVRNDRNKKKKEVKEEGSPDSYELSPQLEELITKVSKAHQETFPSLCQLGKY    141 - 210
TTNSSADHRVQLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLSIADQITLLKAACLDILMLRICTRYT    211 - 280
PEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFAGQLLPLEMDDTETGLLSAICLICGDRMDLEEPEKV    281 - 350
DKLQEPLLEALRLYARRRRPSQPYMFPRMLMKITDLRGISTKGAERAITLKMEIPGPMPPLIREMLENPE    351 - 420
MFEDDSSQPGPHPNASSEDEVPGGQGKGGLKSPA                                        421 - 454
//

Text Mined References (72)

PMID Year Title
26237429 2015 A coding variant in RARG confers susceptibility to anthracycline-induced cardiotoxicity in childhood cancer.
25510432 2015 Critical role of retinoid/rexinoid signaling in mediating transformation and therapeutic response of NUP98-RARG leukemia.
24050824 2013 Association of peroxisome proliferator-activated receptors/retinoic acid receptors with renal diseases.
23798555 2013 Oncogenic activity of retinoic acid receptor ? is exhibited through activation of the Akt/NF-?B and Wnt/?-catenin pathways in cholangiocarcinoma.
23518499 2013 CDK1 interacts with RAR? and plays an important role in treatment response of acute myeloid leukemia.
22901127 2012 Retinoid receptors in gastric cancer: expression and influence on prognosis.
22362749 2012 Retinoic acid and androgen receptors combine to achieve tissue specific control of human prostatic transglutaminase expression: a novel regulatory network with broader significance.
21990348 2011 Rapid and efficient reprogramming of somatic cells to induced pluripotent stem cells by retinoic acid receptor gamma and liver receptor homolog 1.
21401418 2011 Retinoic acid receptor ?-dependent signaling cooperates with BMP2 to induce osteoblastic differentiation of C2C12 cells.
21254357 2011 Association of retinoic acid receptor genes with meningomyelocele.
More...