Property Summary

Ligand Count 94
NCBI Gene PubMed Count 75
PubMed Score 127.03
PubTator Score 165.98

Knowledge Summary

Patent (8,249)


  Differential Expression (7)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.300 5.2e-04
cutaneous lupus erythematosus -1.200 7.8e-03
esophageal adenocarcinoma -1.200 2.1e-02
glioblastoma 1.300 8.3e-04
malignant mesothelioma -1.700 5.7e-06
medulloblastoma, large-cell 1.200 4.1e-04
osteosarcoma 1.738 2.8e-04

Protein-protein Interaction (7)

Gene RIF (46)

AA Sequence

MFEDDSSQPGPHPNASSEDEVPGGQGKGGLKSPA                                        421 - 454

Text Mined References (79)

PMID Year Title