Property Summary

Ligand Count 168
NCBI Gene PubMed Count 221
PubMed Score 310.38
PubTator Score 238.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
adult high grade glioma 1.200 5.0e-04
Astrocytoma, Pilocytic 1.200 1.2e-03
atypical teratoid / rhabdoid tumor 1.200 6.9e-04
chronic lymphosyte leukemia -2.400 1.7e-07
cutaneous lupus erythematosus 1.600 1.4e-02
cystic fibrosis 3.517 1.1e-07
glioblastoma 1.100 5.1e-04
interstitial cystitis 1.500 6.7e-03
invasive ductal carcinoma 1.100 6.9e-03
lung cancer 1.600 1.2e-02
lung carcinoma -1.800 8.3e-19
malignant mesothelioma -3.400 2.7e-07
medulloblastoma 1.300 7.3e-03
medulloblastoma, large-cell 2.200 9.5e-05
pituitary cancer 1.300 3.4e-03
primary Sjogren syndrome 1.200 2.7e-02
tuberculosis 1.200 1.3e-06
ulcerative colitis 1.200 3.7e-03

Gene RIF (215)

AA Sequence

MAWEARREPGPRRAAVRETVMLLLCLGVPTGRPYNVDTESALLYQGPHNTLFGYSVVLHSHGANRWLLVG      1 - 70
APTANWLANASVINPGAIYRCRIGKNPGQTCEQLQLGSPNGEPCGKTCLEERDNQWLGVTLSRQPGENGS     71 - 140
IVTCGHRWKNIFYIKNENKLPTGGCYGVPPDLRTELSKRIAPCYQDYVKKFGENFASCQAGISSFYTKDL    141 - 210
IVMGAPGSSYWTGSLFVYNITTNKYKAFLDKQNQVKFGSYLGYSVGAGHFRSQHTTEVVGGAPQHEQIGK    211 - 280
AYIFSIDEKELNILHEMKGKKLGSYFGASVCAVDLNADGFSDLLVGAPMQSTIREEGRVFVYINSGSGAV    281 - 350
MNAMETNLVGSDKYAARFGESIVNLGDIDNDGFEDVAIGAPQEDDLQGAIYIYNGRADGISSTFSQRIEG    351 - 420
LQISKSLSMFGQSISGQIDADNNGYVDVAVGAFRSDSAVLLRTRPVVIVDASLSHPESVNRTKFDCVENG    421 - 490
WPSVCIDLTLCFSYKGKEVPGYIVLFYNMSLDVNRKAESPPRFYFSSNGTSDVITGSIQVSSREANCRTH    491 - 560
QAFMRKDVRDILTPIQIEAAYHLGPHVISKRSTEEFPPLQPILQQKKEKDIMKKTINFARFCAHENCSAD    561 - 630
LQVSAKIGFLKPHENKTYLAVGSMKTLMLNVSLFNAGDDAYETTLHVKLPVGLYFIKILELEEKQINCEV    631 - 700
TDNSGVVQLDCSIGYIYVDHLSRIDISFLLDVSSLSRAEEDLSITVHATCENEEEMDNLKHSRVTVAIPL    701 - 770
KYEVKLTVHGFVNPTSFVYGSNDENEPETCMVEKMNLTFHVINTGNSMAPNVSVEIMVPNSFSPQTDKLF    771 - 840
NILDVQTTTGECHFENYQRVCALEQQKSAMQTLKGIVRFLSKTDKRLLYCIKADPHCLNFLCNFGKMESG    841 - 910
KEASVHIQLEGRPSILEMDETSALKFEIRATGFPEPNPRVIELNKDENVAHVLLEGLHHQRPKRYFTIVI    911 - 980
ISSSLLLGLIVLLLISYVMWKAGFFKRQYKSILQEENRRDSWSYINSKSNDD                      981 - 1032
//

Text Mined References (227)

PMID Year Title