Property Summary

NCBI Gene PubMed Count 204
Grant Count 51
R01 Count 25
Funding $4,070,750.95
PubMed Score 288.97
PubTator Score 238.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
malignant mesothelioma -3.500 0.000
cutaneous lupus erythematosus 1.600 0.014
chronic lymphosyte leukemia -2.700 0.000
glioblastoma 1.700 0.012
cystic fibrosis 3.984 0.000
atypical teratoid / rhabdoid tumor 1.200 0.001
medulloblastoma 1.300 0.007
medulloblastoma, large-cell 2.200 0.000
tuberculosis 1.200 0.000
lung cancer 1.600 0.012
interstitial cystitis 1.800 0.006
pediatric high grade glioma 1.400 0.004
pilocytic astrocytoma 1.200 0.001
primary Sjogren syndrome 1.200 0.027
lung carcinoma -1.800 0.000
invasive ductal carcinoma 1.100 0.007
ulcerative colitis 1.200 0.004
pituitary cancer 1.300 0.003

MLP Assay (20)

AID Type Active / Inconclusive / Inactive Description
528 screening 2 / 2196 / 21588 Allosteric Agonists for the VLA-4 Integrin
529 screening 48 / 2206 / 21459 Allosteric Antagonists for the VLA-4 Integrin
576 other 146 / 27 / 23610 Auto-fluorescence of compounds effecting screening of VLA-4 Integrin
702 confirmatory 34 / 4 / 24 Dose-Response of Allosteric Antagonists for the VLA-4 Integrin
703 confirmatory 0 / 0 / 5 Dose-Response of Allosteric Agonists for the VLA-4 Integrin
1993 screening 7 / 0 / 11 FPR-induced VLA-4 exposure in U937 cells
1998 summary 0 / 0 / 0 MLSCN HTS Assay for Allosteric Ligands for the VLA-4 Integrin
2557 screening 646 / 0 / 326354 HTS for Identification of VLA-4 Allosteric Modulators from MLPCN library
2617 summary 0 / 0 / 0 Summary of HTS for Identification of VLA-4 Allosteric Modulators
2813 screening 21 / 0 / 1287 HTS for Identification of VLA-4 Allosteric Modulators from Cherry Picked Plates
More...

Gene RIF (210)

PMID Text
26900962 knockdown of PTTG1 increased expression of integrin alpha 4 (ITGA4), ITGA5, and integrin beta 1 (ITGB1); otherwise, RhoA expression was significantly decreased
26779610 Integrin alpha 2 and alpha 4 Yxxphi motifs interact with the endocytic clathrin adaptor, AP2 complex.
26329520 Regulatory CD4 T cells (Treg) cells in co-infected patients present phenotypic alterations and might have dysfunction marked by low expression of Foxp3 and increased expression of molecules not frequently seen on Treg cells, such as CD49d.
26155911 High VLA-4 expression was independently associated with a high probability of complete remission in acute myeloid leukemia patients.
26142332 CD49d and CD26 have independent prognostic value and we suggest its use as a part of routine panel for prognostic stratification of CLL.
26105197 Collectively, these data suggest a role for alpha4beta7 integrin in HIV infection that is influenced by both viral and host factors including the sequence of the HIV gp120 alpha4beta7 binding motif, the cytokine milieu and bacterial vaginosis in the genital tract.
26105197 HIV-1 Env gp120/41 (JRFL Env in the contaxt of HIV-Gag-GFP VLP) binds to ITGA4 on the surface of basophils
26105197 HIV-1 Env gp120/41 (JRFL Env in the contaxt of HIV-Gag-GFP VLP) binds to ITGA4 on the surface of basophils
26034878 Glioma cells induced the migration of BMSCs by promoting the expression of integrin a4.
26018157 HIV-1 Env gp120/41 (JRFL Env in the contaxt of HIV-Gag-GFP VLP) binds to ITGA4 on the surface of basophils
More...

AA Sequence

MAWEARREPGPRRAAVRETVMLLLCLGVPTGRPYNVDTESALLYQGPHNTLFGYSVVLHSHGANRWLLVG      1 - 70
APTANWLANASVINPGAIYRCRIGKNPGQTCEQLQLGSPNGEPCGKTCLEERDNQWLGVTLSRQPGENGS     71 - 140
IVTCGHRWKNIFYIKNENKLPTGGCYGVPPDLRTELSKRIAPCYQDYVKKFGENFASCQAGISSFYTKDL    141 - 210
IVMGAPGSSYWTGSLFVYNITTNKYKAFLDKQNQVKFGSYLGYSVGAGHFRSQHTTEVVGGAPQHEQIGK    211 - 280
AYIFSIDEKELNILHEMKGKKLGSYFGASVCAVDLNADGFSDLLVGAPMQSTIREEGRVFVYINSGSGAV    281 - 350
MNAMETNLVGSDKYAARFGESIVNLGDIDNDGFEDVAIGAPQEDDLQGAIYIYNGRADGISSTFSQRIEG    351 - 420
LQISKSLSMFGQSISGQIDADNNGYVDVAVGAFRSDSAVLLRTRPVVIVDASLSHPESVNRTKFDCVENG    421 - 490
WPSVCIDLTLCFSYKGKEVPGYIVLFYNMSLDVNRKAESPPRFYFSSNGTSDVITGSIQVSSREANCRTH    491 - 560
QAFMRKDVRDILTPIQIEAAYHLGPHVISKRSTEEFPPLQPILQQKKEKDIMKKTINFARFCAHENCSAD    561 - 630
LQVSAKIGFLKPHENKTYLAVGSMKTLMLNVSLFNAGDDAYETTLHVKLPVGLYFIKILELEEKQINCEV    631 - 700
TDNSGVVQLDCSIGYIYVDHLSRIDISFLLDVSSLSRAEEDLSITVHATCENEEEMDNLKHSRVTVAIPL    701 - 770
KYEVKLTVHGFVNPTSFVYGSNDENEPETCMVEKMNLTFHVINTGNSMAPNVSVEIMVPNSFSPQTDKLF    771 - 840
NILDVQTTTGECHFENYQRVCALEQQKSAMQTLKGIVRFLSKTDKRLLYCIKADPHCLNFLCNFGKMESG    841 - 910
KEASVHIQLEGRPSILEMDETSALKFEIRATGFPEPNPRVIELNKDENVAHVLLEGLHHQRPKRYFTIVI    911 - 980
ISSSLLLGLIVLLLISYVMWKAGFFKRQYKSILQEENRRDSWSYINSKSNDD                      981 - 1032
//

Text Mined References (210)

PMID Year Title
26900962 2016 Alteration of Pituitary Tumor Transforming Gene-1 Regulates Trophoblast Invasion via the Integrin/Rho-Family Signaling Pathway.
26779610 2016 Selective integrin endocytosis is driven by interactions between the integrin ?-chain and AP2.
26329520 2015 CD4(+)CD25(High) Treg cells in HIV/HTLV co-infected patients with neuropathy: high expression of Alpha4 integrin and lower expression of Foxp3 transcription factor.
26155911 2015 VLA-4 and CXCR4 expression levels show contrasting prognostic impact (favorable and unfavorable, respectively) in acute myeloid leukemia.
26142332 2015 CD49d and CD26 are independent prognostic markers for disease progression in patients with chronic lymphocytic leukemia.
26105197 2015 South African HIV-1 subtype C transmitted variants with a specific V2 motif show higher dependence on ?4?7 for replication.
26034878 2015 Integrin ?4 is involved in the regulation of glioma-induced motility of bone marrow mesenchymal stem cells.
25973900 2015 Integrin ?4 Enhances Metastasis and May Be Associated with Poor Prognosis in MYCN-low Neuroblastoma.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25902909 2015 Hypermethylation of ITGA4, TFPI2 and VIMENTIN promoters is increased in inflamed colon tissue: putative risk markers for colitis-associated cancer.
More...