Property Summary

NCBI Gene PubMed Count 148
PubMed Score 756.21
PubTator Score 281.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (7)

Disease Target Count P-value
periodontitis 269 2.70089642754276E-15
Breast cancer 3099 5.07679520133747E-15
pilocytic astrocytoma 3086 4.34869555366093E-13
Duchenne muscular dystrophy 602 1.6775048171174E-11
juvenile dermatomyositis 1189 3.30736147865294E-11
lung carcinoma 2844 5.52922236692091E-11
chronic lymphosyte leukemia 232 6.61611455808472E-11
non-small cell lung cancer 2798 7.52972582598013E-11
glioblastoma 5572 1.14043470870949E-8
breast carcinoma 1614 1.25912844809696E-8
lung adenocarcinoma 2714 2.98649843239391E-6
interstitial cystitis 2299 3.57662970629483E-6
ulcerative colitis 2087 6.11991182235841E-6
primary pancreatic ductal adenocarcinoma 1271 8.04000882314509E-6
adult high grade glioma 2148 8.6201739190448E-6
pancreatic cancer 2300 1.34352651469999E-5
ovarian cancer 8492 1.81971917369193E-5
lung cancer 4473 3.60322001686754E-5
limb girdle muscular dystrophy 2A 156 3.88516710708502E-5
atypical teratoid/rhabdoid tumor 1095 1.42733004407203E-4
primitive neuroectodermal tumor 3031 1.90487518259653E-4
tuberculosis 1563 2.40335520983226E-4
Down syndrome 548 2.72474221581839E-4
acute quadriplegic myopathy 1157 2.8096732044619E-4
fascioscapulohumeral muscular dystrophy 100 3.77938099597974E-4
oligodendroglioma 2849 5.32640338557124E-4
ependymoma 2514 8.45689464389059E-4
autosomal dominant Emery-Dreifuss muscular dystrophy 499 8.62664464851361E-4
mucosa-associated lymphoid tissue lymphoma 480 9.40399676214633E-4
osteosarcoma 7933 0.00116862379515902
Becker muscular dystrophy 187 0.00174028425591079
nasopharyngeal carcinoma 1056 0.00200233698837597
hereditary spastic paraplegia 313 0.00286359350294757
astrocytic glioma 2241 0.00309158944180184
cystic fibrosis 1670 0.00353495638983258
group 4 medulloblastoma 1875 0.00410372648136951
Rheumatoid Arthritis 1171 0.00465444934805144
chronic kidney disease 90 0.00528091524299426
head and neck cancer and chronic obstructive pulmonary disease 237 0.00898364787213865
dermatomyositis 967 0.0111349239280518
psoriasis 6685 0.0171377099425599
gastric carcinoma 832 0.017939411165973
esophageal adenocarcinoma 737 0.0186261067462273
diabetes mellitus 1663 0.0245865796047222
invasive ductal carcinoma 2950 0.0254255463910616
ductal carcinoma in situ 1745 0.0287140461623728
pituitary cancer 1972 0.0303496050215567
aldosterone-producing adenoma 664 0.0304491868712544
adrenocortical carcinoma 1427 0.0312120119041161
Pneumonia 133 0.0418052433813299
pterygium 74 0.0437524439011272
colon cancer 1475 0.0460669313017937
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Cataract 104 0.0 4.0
Disease Target Count
Wagner disease 1
Disease Target Count
Wagner vitreoretinopathy 1

Expression

  Differential Expression (52)

Disease log2 FC p
Rheumatoid Arthritis 1.200 0.005
astrocytic glioma 4.000 0.003
ependymoma 4.400 0.001
oligodendroglioma 3.500 0.001
esophageal adenocarcinoma 2.600 0.019
psoriasis -1.100 0.017
glioblastoma 2.700 0.000
osteosarcoma 1.745 0.001
chronic lymphosyte leukemia -3.500 0.000
group 4 medulloblastoma 2.300 0.004
periodontitis 1.300 0.000
atypical teratoid/rhabdoid tumor 2.400 0.000
primitive neuroectodermal tumor 3.000 0.000
Duchenne muscular dystrophy 2.381 0.000
autosomal dominant Emery-Dreifuss muscul... 1.751 0.001
limb girdle muscular dystrophy 2A 1.626 0.000
Becker muscular dystrophy 1.468 0.002
fascioscapulohumeral muscular dystrophy 1.137 0.000
hereditary spastic paraplegia -1.000 0.003
juvenile dermatomyositis 1.769 0.000
acute quadriplegic myopathy 1.705 0.000
adrenocortical carcinoma -1.879 0.031
chronic kidney disease 2.700 0.005
tuberculosis 1.200 0.000
primary pancreatic ductal adenocarcinoma 4.936 0.000
non-small cell lung cancer 1.890 0.000
lung cancer 2.100 0.000
colon cancer 1.100 0.046
pancreatic cancer 5.000 0.000
diabetes mellitus -2.100 0.025
Breast cancer 3.300 0.000
interstitial cystitis 3.400 0.000
cystic fibrosis 2.200 0.004
adult high grade glioma 2.800 0.000
pilocytic astrocytoma 4.500 0.000
aldosterone-producing adenoma -1.805 0.030
Pneumonia 1.300 0.042
invasive ductal carcinoma 1.407 0.025
nasopharyngeal carcinoma 1.800 0.002
lung adenocarcinoma 2.480 0.000
lung carcinoma -1.600 0.000
breast carcinoma 1.500 0.000
gastric carcinoma 2.600 0.018
pterygium 1.400 0.044
mucosa-associated lymphoid tissue lympho... 3.207 0.001
ductal carcinoma in situ 1.400 0.029
ulcerative colitis 2.700 0.000
ovarian cancer 5.000 0.000
pituitary cancer -1.300 0.030
Down syndrome 1.500 0.000
dermatomyositis 1.800 0.011
head and neck cancer and chronic obstruc... 1.200 0.009

Synonym

Accession P13611 P20754 Q13010 Q13189 Q15123 Q9UCL9 Q9UNW5
Symbols WGN
ERVR
GHAP
PG-M
WGN1
CSPG2

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG

Gene RIF (111)

PMID Text
26873137 VCAN and VEGF were associated with survival in CRC patients with PM after CRS and HIPEC
26752747 Versican is a novel modulator of hepatic fibrosis.
26395512 Versican localizes to the nucleus in proliferating mesenchymal cells and suggest role in mitotic spindle organization during cell division.
26176948 Versican V1 overexpression induces a myofibroblast-like phenotype in cultured fibroblasts.
26057378 versican mRNA is up-regulated much more highly (>600 fold) by long term hypoxia (5 days) than by 1 day of hypoxia.
25915825 Versican upregulation in Sezary cells alters growth, motility and resistance to chemotherapy.
25623955 Significant elevation of VCAN and its associated molecules imply their role in multiple myeloma
25562163 Our results suggest that TGF-beta1 up-regulates versican expression by suppressing miR-143, and this pathway is important for osteosarcoma cell migration and invasion.
25320080 Versican regulates the growth of leiomyosarcoma tumors.
25275064 Versican expression in tumor epithelial cells predicts a good prognosis for gastric cancer patients.
More...

AA Sequence

MFINIKSILWMCSTLIVTHALHKVKVGKSPPVRGSLSGKVSLPCHFSTMPTLPPSYNTSEFLRIKWSKIE      1 - 70
VDKNGKDLKETTVLVAQNGNIKIGQDYKGRVSVPTHPEAVGDASLTVVKLLASDAGLYRCDVMYGIEDTQ     71 - 140
DTVSLTVDGVVFHYRAATSRYTLNFEAAQKACLDVGAVIATPEQLFAAYEDGFEQCDAGWLADQTVRYPI    141 - 210
RAPRVGCYGDKMGKAGVRTYGFRSPQETYDVYCYVDHLDGDVFHLTVPSKFTFEEAAKECENQDARLATV    211 - 280
GELQAAWRNGFDQCDYGWLSDASVRHPVTVARAQCGGGLLGVRTLYRFENQTGFPPPDSRFDAYCFKPKE    281 - 350
ATTIDLSILAETASPSLSKEPQMVSDRTTPIIPLVDELPVIPTEFPPVGNIVSFEQKATVQPQAITDSLA    351 - 420
TKLPTPTGSTKKPWDMDDYSPSASGPLGKLDISEIKEEVLQSTTGVSHYATDSWDGVVEDKQTQESVTQI    421 - 490
EQIEVGPLVTSMEILKHIPSKEFPVTETPLVTARMILESKTEKKMVSTVSELVTTGHYGFTLGEEDDEDR    491 - 560
TLTVGSDESTLIFDQIPEVITVSKTSEDTIHTHLEDLESVSASTTVSPLIMPDNNGSSMDDWEERQTSGR    561 - 630
ITEEFLGKYLSTTPFPSQHRTEIELFPYSGDKILVEGISTVIYPSLQTEMTHRRERTETLIPEMRTDTYT    631 - 700
DEIQEEITKSPFMGKTEEEVFSGMKLSTSLSEPIHVTESSVEMTKSFDFPTLITKLSAEPTEVRDMEEDF    701 - 770
TATPGTTKYDENITTVLLAHGTLSVEAATVSKWSWDEDNTTSKPLESTEPSASSKLPPALLTTVGMNGKD    771 - 840
KDIPSFTEDGADEFTLIPDSTQKQLEEVTDEDIAAHGKFTIRFQPTTSTGIAEKSTLRDSTTEEKVPPIT    841 - 910
STEGQVYATMEGSALGEVEDVDLSKPVSTVPQFAHTSEVEGLAFVSYSSTQEPTTYVDSSHTIPLSVIPK    911 - 980
TDWGVLVPSVPSEDEVLGEPSQDILVIDQTRLEATISPETMRTTKITEGTTQEEFPWKEQTAEKPVPALS    981 - 1050
STAWTPKEAVTPLDEQEGDGSAYTVSEDELLTGSERVPVLETTPVGKIDHSVSYPPGAVTEHKVKTDEVV   1051 - 1120
TLTPRIGPKVSLSPGPEQKYETEGSSTTGFTSSLSPFSTHITQLMEETTTEKTSLEDIDLGSGLFEKPKA   1121 - 1190
TELIEFSTIKVTVPSDITTAFSSVDRLHTTSAFKPSSAITKKPPLIDREPGEETTSDMVIIGESTSHVPP   1191 - 1260
TTLEDIVAKETETDIDREYFTTSSPPATQPTRPPTVEDKEAFGPQALSTPQPPASTKFHPDINVYIIEVR   1261 - 1330
ENKTGRMSDLSVIGHPIDSESKEDEPCSEETDPVHDLMAEILPEFPDIIEIDLYHSEENEEEEEECANAT   1331 - 1400
DVTTTPSVQYINGKHLVTTVPKDPEAAEARRGQFESVAPSQNFSDSSESDTHPFVIAKTELSTAVQPNES   1401 - 1470
TETTESLEVTWKPETYPETSEHFSGGEPDVFPTVPFHEEFESGTAKKGAESVTERDTEVGHQAHEHTEPV   1471 - 1540
SLFPEESSGEIAIDQESQKIAFARATEVTFGEEVEKSTSVTYTPTIVPSSASAYVSEEEAVTLIGNPWPD   1541 - 1610
DLLSTKESWVEATPRQVVELSGSSSIPITEGSGEAEEDEDTMFTMVTDLSQRNTTDTLITLDTSRIITES   1611 - 1680
FFEVPATTIYPVSEQPSAKVVPTKFVSETDTSEWISSTTVEEKKRKEEEGTTGTASTFEVYSSTQRSDQL   1681 - 1750
ILPFELESPNVATSSDSGTRKSFMSLTTPTQSEREMTDSTPVFTETNTLENLGAQTTEHSSIHQPGVQEG   1751 - 1820
LTTLPRSPASVFMEQGSGEAAADPETTTVSSFSLNVEYAIQAEKEVAGTLSPHVETTFSTEPTGLVLSTV   1821 - 1890
MDRVVAENITQTSREIVISERLGEPNYGAEIRGFSTGFPLEEDFSGDFREYSTVSHPIAKEETVMMEGSG   1891 - 1960
DAAFRDTQTSPSTVPTSVHISHISDSEGPSSTMVSTSAFPWEEFTSSAEGSGEQLVTVSSSVVPVLPSAV   1961 - 2030
QKFSGTASSIIDEGLGEVGTVNEIDRRSTILPTAEVEGTKAPVEKEEVKVSGTVSTNFPQTIEPAKLWSR   2031 - 2100
QEVNPVRQEIESETTSEEQIQEEKSFESPQNSPATEQTIFDSQTFTETELKTTDYSVLTTKKTYSDDKEM   2101 - 2170
KEEDTSLVNMSTPDPDANGLESYTTLPEATEKSHFFLATALVTESIPAEHVVTDSPIKKEESTKHFPKGM   2171 - 2240
RPTIQESDTELLFSGLGSGEEVLPTLPTESVNFTEVEQINNTLYPHTSQVESTSSDKIEDFNRMENVAKE   2241 - 2310
VGPLVSQTDIFEGSGSVTSTTLIEILSDTGAEGPTVAPLPFSTDIGHPQNQTVRWAEEIQTSRPQTITEQ   2311 - 2380
DSNKNSSTAEINETTTSSTDFLARAYGFEMAKEFVTSAPKPSDLYYEPSGEGSGEVDIVDSFHTSATTQA   2381 - 2450
TRQESSTTFVSDGSLEKHPEVPSAKAVTADGFPTVSVMLPLHSEQNKSSPDPTSTLSNTVSYERSTDGSF   2451 - 2520
QDRFREFEDSTLKPNRKKPTENIIIDLDKEDKDLILTITESTILEILPELTSDKNTIIDIDHTKPVYEDI   2521 - 2590
LGMQTDIDTEVPSEPHDSNDESNDDSTQVQEIYEAAVNLSLTEETFEGSADVLASYTQATHDESMTYEDR   2591 - 2660
SQLDHMGFHFTTGIPAPSTETELDVLLPTATSLPIPRKSATVIPEIEGIKAEAKALDDMFESSTLSDGQA   2661 - 2730
IADQSEIIPTLGQFERTQEEYEDKKHAGPSFQPEFSSGAEEALVDHTPYLSIATTHLMDQSVTEVPDVME   2731 - 2800
GSNPPYYTDTTLAVSTFAKLSSQTPSSPLTIYSGSEASGHTEIPQPSALPGIDVGSSVMSPQDSFKEIHV   2801 - 2870
NIEATFKPSSEEYLHITEPPSLSPDTKLEPSEDDGKPELLEEMEASPTELIAVEGTEILQDFQNKTDGQV   2871 - 2940
SGEAIKMFPTIKTPEAGTVITTADEIELEGATQWPHSTSASATYGVEAGVVPWLSPQTSERPTLSSSPEI   2941 - 3010
NPETQAALIRGQDSTIAASEQQVAARILDSNDQATVNPVEFNTEVATPPFSLLETSNETDFLIGINEESV   3011 - 3080
EGTAIYLPGPDRCKMNPCLNGGTCYPTETSYVCTCVPGYSGDQCELDFDECHSNPCRNGATCVDGFNTFR   3081 - 3150
CLCLPSYVGALCEQDTETCDYGWHKFQGQCYKYFAHRRTWDAAERECRLQGAHLTSILSHEEQMFVNRVG   3151 - 3220
HDYQWIGLNDKMFEHDFRWTDGSTLQYENWRPNQPDSFFSAGEDCVVIIWHENGQWNDVPCNYHLTYTCK   3221 - 3290
KGTVACGQPPVVENAKTFGKMKPRYEINSLIRYHCKDGFIQRHLPTIRCLGNGRWAIPKITCMNPSAYQR   3291 - 3360
TYSMKYFKNSSSAKDNSINTSKHDHRWSRRWQESRR                                     3361 - 3396
//

Text Mined References (150)

PMID Year Title
26873137 2016 Versican and vascular endothelial growth factor expression levels in peritoneal metastases from colorectal cancer are associated with survival after cytoreductive surgery and hyperthermic intraperitoneal chemotherapy.
26752747 2016 Versican: a novel modulator of hepatic fibrosis.
26395512 Versican localizes to the nucleus in proliferating mesenchymal cells.
26176948 2015 Versican V1 Overexpression Induces a Myofibroblast-Like Phenotype in Cultured Fibroblasts.
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
26057378 2015 Mechanisms of Hypoxic Up-Regulation of Versican Gene Expression in Macrophages.
25915825 2015 Versican upregulation in Sézary cells alters growth, motility and resistance to chemotherapy.
25623955 2015 Versican and its associated molecules: potential diagnostic markers for multiple myeloma.
25562163 2014 TGF-?1 promotes osteosarcoma cell migration and invasion through the miR-143-versican pathway.
25320080 2014 A role for versican in the development of leiomyosarcoma.
More...