Property Summary

NCBI Gene PubMed Count 148
Grant Count 181
R01 Count 86
Funding $26,241,532.75
PubMed Score 756.21
PubTator Score 281.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (68)

Disease Z-score Confidence
Stickler syndrome 13 4.427 2.2
Cancer 2,346 4.009 2.0
Vitreous syneresis 6 3.714 1.9
Vitreoretinal dystrophy 4 3.654 1.8
Plague 19 3.616 1.8
Atherosclerosis 275 3.391 1.7
Leiomyoma 25 3.354 1.7
Retinal detachment 33 3.306 1.7
Uterine fibroid 29 3.13 1.6
Adenoid Cystic Carcinoma 99
Becker muscular dystrophy 187
Breast cancer 3,094
Carcinoma 2,147 1.0
Cataract 104 4.0
Down syndrome 548
Duchenne muscular dystrophy 602
Endometriosis 535
Hyaloideoretinal degeneration of Wagner 2
Laryngeal squamous cell carcinoma 6
Pneumonia 133
Rheumatoid Arthritis 1,160
Salivary Gland Neoplasms 45
acute quadriplegic myopathy 1,157
adrenocortical carcinoma 1,427
adult high grade glioma 2,148
aldosterone-producing adenoma 664
astrocytic glioma 2,241
atypical teratoid/rhabdoid tumor 1,095
autosomal dominant Emery-Dreifuss muscul... 499 
breast carcinoma 1,614
chronic kidney disease 90
chronic lymphosyte leukemia 232
colon cancer 1,475
cystic fibrosis 1,665
dermatomyositis 933
diabetes mellitus 1,663
ductal carcinoma in situ 1,745
ependymoma 2,514
esophageal adenocarcinoma 737
fascioscapulohumeral muscular dystrophy 100
gastric carcinoma 832
glioblastoma 5,572
group 4 medulloblastoma 1,875
head and neck cancer and chronic obstruc... 237 
hereditary spastic paraplegia 313
interstitial cystitis 2,299
invasive ductal carcinoma 2,950
juvenile dermatomyositis 1,189
limb girdle muscular dystrophy 2A 156
lung adenocarcinoma 2,713
lung cancer 4,466
lung carcinoma 2,844
mucosa-associated lymphoid tissue lympho... 480 
nasopharyngeal carcinoma 1,056
non-small cell lung cancer 2,798
oligodendroglioma 2,849
osteosarcoma 7,933
ovarian cancer 8,484
pancreatic cancer 2,300
periodontitis 269
pilocytic astrocytoma 3,086
pituitary cancer 1,972
primary pancreatic ductal adenocarcinoma 1,271
primitive neuroectodermal tumor 3,031
psoriasis 6,685
pterygium 74
tuberculosis 1,557
ulcerative colitis 2,087

Expression

  Differential Expression (52)

Disease log2 FC p
Rheumatoid Arthritis 1.200 0.005
astrocytic glioma 4.000 0.003
ependymoma 4.400 0.001
oligodendroglioma 3.500 0.001
esophageal adenocarcinoma 2.600 0.019
psoriasis -1.100 0.017
glioblastoma 2.700 0.000
osteosarcoma 1.745 0.001
chronic lymphosyte leukemia -3.500 0.000
group 4 medulloblastoma 2.300 0.004
periodontitis 1.300 0.000
atypical teratoid/rhabdoid tumor 2.400 0.000
primitive neuroectodermal tumor 3.000 0.000
Duchenne muscular dystrophy 2.381 0.000
autosomal dominant Emery-Dreifuss muscul... 1.751 0.001
limb girdle muscular dystrophy 2A 1.626 0.000
Becker muscular dystrophy 1.468 0.002
fascioscapulohumeral muscular dystrophy 1.137 0.000
hereditary spastic paraplegia -1.000 0.003
juvenile dermatomyositis 1.769 0.000
acute quadriplegic myopathy 1.705 0.000
adrenocortical carcinoma -1.879 0.031
chronic kidney disease 2.700 0.005
tuberculosis 1.200 0.000
primary pancreatic ductal adenocarcinoma 4.936 0.000
non-small cell lung cancer 1.890 0.000
lung cancer 2.100 0.000
colon cancer 1.100 0.046
pancreatic cancer 5.000 0.000
diabetes mellitus -2.100 0.025
Breast cancer 3.300 0.000
interstitial cystitis 3.400 0.000
cystic fibrosis 2.200 0.004
adult high grade glioma 2.800 0.000
pilocytic astrocytoma 4.500 0.000
aldosterone-producing adenoma -1.805 0.030
Pneumonia 1.300 0.042
invasive ductal carcinoma 1.407 0.025
nasopharyngeal carcinoma 1.800 0.002
lung adenocarcinoma 2.480 0.000
lung carcinoma -1.600 0.000
breast carcinoma 1.500 0.000
gastric carcinoma 2.600 0.018
pterygium 1.400 0.044
mucosa-associated lymphoid tissue lympho... 3.207 0.001
ductal carcinoma in situ 1.400 0.029
ulcerative colitis 2.700 0.000
ovarian cancer 5.000 0.000
pituitary cancer -1.300 0.030
Down syndrome 1.500 0.000
dermatomyositis 1.800 0.011
head and neck cancer and chronic obstruc... 1.200 0.009

Synonym

Accession P13611 P20754 Q13010 Q13189 Q15123 Q9UCL9 Q9UNW5
Symbols WGN
ERVR
GHAP
PG-M
WGN1
CSPG2

Gene

Gene RIF (111)

PMID Text
26873137 VCAN and VEGF were associated with survival in CRC patients with PM after CRS and HIPEC
26752747 Versican is a novel modulator of hepatic fibrosis.
26395512 Versican localizes to the nucleus in proliferating mesenchymal cells and suggest role in mitotic spindle organization during cell division.
26176948 Versican V1 overexpression induces a myofibroblast-like phenotype in cultured fibroblasts.
26057378 versican mRNA is up-regulated much more highly (>600 fold) by long term hypoxia (5 days) than by 1 day of hypoxia.
25915825 Versican upregulation in Sezary cells alters growth, motility and resistance to chemotherapy.
25623955 Significant elevation of VCAN and its associated molecules imply their role in multiple myeloma
25562163 Our results suggest that TGF-beta1 up-regulates versican expression by suppressing miR-143, and this pathway is important for osteosarcoma cell migration and invasion.
25320080 Versican regulates the growth of leiomyosarcoma tumors.
25275064 Versican expression in tumor epithelial cells predicts a good prognosis for gastric cancer patients.
More...

AA Sequence

MFINIKSILWMCSTLIVTHALHKVKVGKSPPVRGSLSGKVSLPCHFSTMPTLPPSYNTSEFLRIKWSKIE      1 - 70
VDKNGKDLKETTVLVAQNGNIKIGQDYKGRVSVPTHPEAVGDASLTVVKLLASDAGLYRCDVMYGIEDTQ     71 - 140
DTVSLTVDGVVFHYRAATSRYTLNFEAAQKACLDVGAVIATPEQLFAAYEDGFEQCDAGWLADQTVRYPI    141 - 210
RAPRVGCYGDKMGKAGVRTYGFRSPQETYDVYCYVDHLDGDVFHLTVPSKFTFEEAAKECENQDARLATV    211 - 280
GELQAAWRNGFDQCDYGWLSDASVRHPVTVARAQCGGGLLGVRTLYRFENQTGFPPPDSRFDAYCFKPKE    281 - 350
ATTIDLSILAETASPSLSKEPQMVSDRTTPIIPLVDELPVIPTEFPPVGNIVSFEQKATVQPQAITDSLA    351 - 420
TKLPTPTGSTKKPWDMDDYSPSASGPLGKLDISEIKEEVLQSTTGVSHYATDSWDGVVEDKQTQESVTQI    421 - 490
EQIEVGPLVTSMEILKHIPSKEFPVTETPLVTARMILESKTEKKMVSTVSELVTTGHYGFTLGEEDDEDR    491 - 560
TLTVGSDESTLIFDQIPEVITVSKTSEDTIHTHLEDLESVSASTTVSPLIMPDNNGSSMDDWEERQTSGR    561 - 630
ITEEFLGKYLSTTPFPSQHRTEIELFPYSGDKILVEGISTVIYPSLQTEMTHRRERTETLIPEMRTDTYT    631 - 700
DEIQEEITKSPFMGKTEEEVFSGMKLSTSLSEPIHVTESSVEMTKSFDFPTLITKLSAEPTEVRDMEEDF    701 - 770
TATPGTTKYDENITTVLLAHGTLSVEAATVSKWSWDEDNTTSKPLESTEPSASSKLPPALLTTVGMNGKD    771 - 840
KDIPSFTEDGADEFTLIPDSTQKQLEEVTDEDIAAHGKFTIRFQPTTSTGIAEKSTLRDSTTEEKVPPIT    841 - 910
STEGQVYATMEGSALGEVEDVDLSKPVSTVPQFAHTSEVEGLAFVSYSSTQEPTTYVDSSHTIPLSVIPK    911 - 980
TDWGVLVPSVPSEDEVLGEPSQDILVIDQTRLEATISPETMRTTKITEGTTQEEFPWKEQTAEKPVPALS    981 - 1050
STAWTPKEAVTPLDEQEGDGSAYTVSEDELLTGSERVPVLETTPVGKIDHSVSYPPGAVTEHKVKTDEVV   1051 - 1120
TLTPRIGPKVSLSPGPEQKYETEGSSTTGFTSSLSPFSTHITQLMEETTTEKTSLEDIDLGSGLFEKPKA   1121 - 1190
TELIEFSTIKVTVPSDITTAFSSVDRLHTTSAFKPSSAITKKPPLIDREPGEETTSDMVIIGESTSHVPP   1191 - 1260
TTLEDIVAKETETDIDREYFTTSSPPATQPTRPPTVEDKEAFGPQALSTPQPPASTKFHPDINVYIIEVR   1261 - 1330
ENKTGRMSDLSVIGHPIDSESKEDEPCSEETDPVHDLMAEILPEFPDIIEIDLYHSEENEEEEEECANAT   1331 - 1400
DVTTTPSVQYINGKHLVTTVPKDPEAAEARRGQFESVAPSQNFSDSSESDTHPFVIAKTELSTAVQPNES   1401 - 1470
TETTESLEVTWKPETYPETSEHFSGGEPDVFPTVPFHEEFESGTAKKGAESVTERDTEVGHQAHEHTEPV   1471 - 1540
SLFPEESSGEIAIDQESQKIAFARATEVTFGEEVEKSTSVTYTPTIVPSSASAYVSEEEAVTLIGNPWPD   1541 - 1610
DLLSTKESWVEATPRQVVELSGSSSIPITEGSGEAEEDEDTMFTMVTDLSQRNTTDTLITLDTSRIITES   1611 - 1680
FFEVPATTIYPVSEQPSAKVVPTKFVSETDTSEWISSTTVEEKKRKEEEGTTGTASTFEVYSSTQRSDQL   1681 - 1750
ILPFELESPNVATSSDSGTRKSFMSLTTPTQSEREMTDSTPVFTETNTLENLGAQTTEHSSIHQPGVQEG   1751 - 1820
LTTLPRSPASVFMEQGSGEAAADPETTTVSSFSLNVEYAIQAEKEVAGTLSPHVETTFSTEPTGLVLSTV   1821 - 1890
MDRVVAENITQTSREIVISERLGEPNYGAEIRGFSTGFPLEEDFSGDFREYSTVSHPIAKEETVMMEGSG   1891 - 1960
DAAFRDTQTSPSTVPTSVHISHISDSEGPSSTMVSTSAFPWEEFTSSAEGSGEQLVTVSSSVVPVLPSAV   1961 - 2030
QKFSGTASSIIDEGLGEVGTVNEIDRRSTILPTAEVEGTKAPVEKEEVKVSGTVSTNFPQTIEPAKLWSR   2031 - 2100
QEVNPVRQEIESETTSEEQIQEEKSFESPQNSPATEQTIFDSQTFTETELKTTDYSVLTTKKTYSDDKEM   2101 - 2170
KEEDTSLVNMSTPDPDANGLESYTTLPEATEKSHFFLATALVTESIPAEHVVTDSPIKKEESTKHFPKGM   2171 - 2240
RPTIQESDTELLFSGLGSGEEVLPTLPTESVNFTEVEQINNTLYPHTSQVESTSSDKIEDFNRMENVAKE   2241 - 2310
VGPLVSQTDIFEGSGSVTSTTLIEILSDTGAEGPTVAPLPFSTDIGHPQNQTVRWAEEIQTSRPQTITEQ   2311 - 2380
DSNKNSSTAEINETTTSSTDFLARAYGFEMAKEFVTSAPKPSDLYYEPSGEGSGEVDIVDSFHTSATTQA   2381 - 2450
TRQESSTTFVSDGSLEKHPEVPSAKAVTADGFPTVSVMLPLHSEQNKSSPDPTSTLSNTVSYERSTDGSF   2451 - 2520
QDRFREFEDSTLKPNRKKPTENIIIDLDKEDKDLILTITESTILEILPELTSDKNTIIDIDHTKPVYEDI   2521 - 2590
LGMQTDIDTEVPSEPHDSNDESNDDSTQVQEIYEAAVNLSLTEETFEGSADVLASYTQATHDESMTYEDR   2591 - 2660
SQLDHMGFHFTTGIPAPSTETELDVLLPTATSLPIPRKSATVIPEIEGIKAEAKALDDMFESSTLSDGQA   2661 - 2730
IADQSEIIPTLGQFERTQEEYEDKKHAGPSFQPEFSSGAEEALVDHTPYLSIATTHLMDQSVTEVPDVME   2731 - 2800
GSNPPYYTDTTLAVSTFAKLSSQTPSSPLTIYSGSEASGHTEIPQPSALPGIDVGSSVMSPQDSFKEIHV   2801 - 2870
NIEATFKPSSEEYLHITEPPSLSPDTKLEPSEDDGKPELLEEMEASPTELIAVEGTEILQDFQNKTDGQV   2871 - 2940
SGEAIKMFPTIKTPEAGTVITTADEIELEGATQWPHSTSASATYGVEAGVVPWLSPQTSERPTLSSSPEI   2941 - 3010
NPETQAALIRGQDSTIAASEQQVAARILDSNDQATVNPVEFNTEVATPPFSLLETSNETDFLIGINEESV   3011 - 3080
EGTAIYLPGPDRCKMNPCLNGGTCYPTETSYVCTCVPGYSGDQCELDFDECHSNPCRNGATCVDGFNTFR   3081 - 3150
CLCLPSYVGALCEQDTETCDYGWHKFQGQCYKYFAHRRTWDAAERECRLQGAHLTSILSHEEQMFVNRVG   3151 - 3220
HDYQWIGLNDKMFEHDFRWTDGSTLQYENWRPNQPDSFFSAGEDCVVIIWHENGQWNDVPCNYHLTYTCK   3221 - 3290
KGTVACGQPPVVENAKTFGKMKPRYEINSLIRYHCKDGFIQRHLPTIRCLGNGRWAIPKITCMNPSAYQR   3291 - 3360
TYSMKYFKNSSSAKDNSINTSKHDHRWSRRWQESRR                                     3361 - 3396
//

Text Mined References (150)

PMID Year Title
26873137 2016 Versican and vascular endothelial growth factor expression levels in peritoneal metastases from colorectal cancer are associated with survival after cytoreductive surgery and hyperthermic intraperitoneal chemotherapy.
26752747 2016 Versican: a novel modulator of hepatic fibrosis.
26395512 Versican localizes to the nucleus in proliferating mesenchymal cells.
26176948 2015 Versican V1 Overexpression Induces a Myofibroblast-Like Phenotype in Cultured Fibroblasts.
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
26057378 2015 Mechanisms of Hypoxic Up-Regulation of Versican Gene Expression in Macrophages.
25915825 2015 Versican upregulation in Sézary cells alters growth, motility and resistance to chemotherapy.
25623955 2015 Versican and its associated molecules: potential diagnostic markers for multiple myeloma.
25562163 2014 TGF-?1 promotes osteosarcoma cell migration and invasion through the miR-143-versican pathway.
25320080 2014 A role for versican in the development of leiomyosarcoma.
More...