Property Summary

NCBI Gene PubMed Count 160
PubMed Score 795.37
PubTator Score 281.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count P-value
periodontitis 293 3.9e-14
lung carcinoma 2843 5.5e-11
Astrocytoma, Pilocytic 3081 8.4e-11
juvenile dermatomyositis 1187 1.6e-10
non-small cell lung cancer 2890 2.8e-09
breast carcinoma 1637 1.3e-08
glioblastoma 5792 1.2e-07
chronic lymphosyte leukemia 204 3.1e-07
Duchenne muscular dystrophy 601 3.0e-06
adult high grade glioma 3801 1.1e-05
ovarian cancer 8519 1.8e-05
limb girdle muscular dystrophy 2A 213 7.3e-05
tuberculosis 2010 2.1e-04
ulcerative colitis 1819 3.5e-04
fascioscapulohumeral muscular dystrophy 100 3.8e-04
primitive neuroectodermal tumor 3035 5.3e-04
cystic fibrosis 1695 6.6e-04
autosomal dominant Emery-Dreifuss muscular dystrophy 510 7.3e-04
mucosa-associated lymphoid tissue lymphoma 484 9.4e-04
acute quadriplegic myopathy 1158 1.1e-03
pancreatic cancer 2398 1.1e-03
nasopharyngeal carcinoma 1058 2.0e-03
hereditary spastic paraplegia 318 2.9e-03
lung adenocarcinoma 2716 3.0e-03
head and neck cancer and chronic obstructive pulmonary disease 239 3.4e-03
Rheumatoid arthritis 1191 4.7e-03
Down syndrome 499 4.7e-03
Becker muscular dystrophy 191 5.3e-03
astrocytic glioma 2597 7.1e-03
oligodendroglioma 2850 7.9e-03
osteosarcoma 7950 9.4e-03
ependymoma 4679 1.1e-02
gastric carcinoma 807 1.2e-02
pancreatic ductal adenocarcinoma liver metastasis 1962 1.4e-02
psoriasis 6694 1.7e-02
esophageal adenocarcinoma 737 1.9e-02
group 4 medulloblastoma 1855 1.9e-02
atypical teratoid / rhabdoid tumor 5112 2.1e-02
lung cancer 4740 2.1e-02
diabetes mellitus 1728 2.5e-02
pituitary cancer 1972 2.5e-02
invasive ductal carcinoma 2950 2.5e-02
interstitial cystitis 2312 2.7e-02
ductal carcinoma in situ 1744 2.9e-02
aldosterone-producing adenoma 665 3.1e-02
adrenocortical carcinoma 1428 3.1e-02
Breast cancer 3577 3.5e-02
dermatomyositis 966 3.9e-02
Pneumonia 174 4.1e-02
pterygium 76 4.4e-02
chronic kidney disease 90 4.5e-02
colon cancer 1478 4.6e-02
Disease Target Count Z-score Confidence
Mental Depression 333 0.0 0.9
Disease Target Count
Wagner disease 1

Expression

  Differential Expression (52)

Disease log2 FC p
lung cancer 1.100 2.1e-02
acute quadriplegic myopathy 1.372 1.1e-03
adrenocortical carcinoma -1.879 3.1e-02
adult high grade glioma 2.600 1.1e-05
aldosterone-producing adenoma -1.069 3.1e-02
astrocytic glioma 3.200 7.1e-03
Astrocytoma, Pilocytic 3.800 8.4e-11
atypical teratoid / rhabdoid tumor 1.500 2.1e-02
autosomal dominant Emery-Dreifuss muscul... 1.532 7.3e-04
Becker muscular dystrophy 1.174 5.3e-03
Breast cancer 2.500 3.5e-02
breast carcinoma 1.500 1.3e-08
chronic kidney disease 1.800 4.5e-02
chronic lymphosyte leukemia -1.300 3.1e-07
colon cancer 1.100 4.6e-02
cystic fibrosis 2.000 6.6e-04
dermatomyositis 1.100 3.9e-02
diabetes mellitus -2.100 2.5e-02
Down syndrome 1.100 4.7e-03
Duchenne muscular dystrophy 1.101 3.0e-06
ductal carcinoma in situ 1.400 2.9e-02
ependymoma 3.100 1.1e-02
esophageal adenocarcinoma 2.600 1.9e-02
fascioscapulohumeral muscular dystrophy 1.137 3.8e-04
gastric carcinoma 2.000 1.2e-02
glioblastoma 2.300 1.2e-07
group 4 medulloblastoma 1.700 1.9e-02
head and neck cancer and chronic obstruc... 1.100 3.4e-03
hereditary spastic paraplegia -1.000 2.9e-03
interstitial cystitis 1.400 2.7e-02
invasive ductal carcinoma 1.407 2.5e-02
juvenile dermatomyositis 1.487 1.6e-10
limb girdle muscular dystrophy 2A 1.346 7.3e-05
lung adenocarcinoma 1.245 3.0e-03
lung carcinoma -1.600 5.5e-11
mucosa-associated lymphoid tissue lympho... 3.207 9.4e-04
nasopharyngeal carcinoma 1.800 2.0e-03
non-small cell lung cancer 1.476 2.8e-09
oligodendroglioma 2.400 7.9e-03
osteosarcoma 1.354 9.4e-03
ovarian cancer 5.000 1.8e-05
pancreatic cancer 1.900 1.1e-03
pancreatic ductal adenocarcinoma liver m... 1.251 1.4e-02
periodontitis 1.200 3.9e-14
pituitary cancer -1.200 2.5e-02
Pneumonia 1.200 4.1e-02
primitive neuroectodermal tumor 2.700 5.3e-04
psoriasis -1.100 1.7e-02
pterygium 1.400 4.4e-02
Rheumatoid arthritis 1.200 4.7e-03
tuberculosis 1.100 2.1e-04
ulcerative colitis 1.600 3.5e-04

 OMIM Phenotype (1)

Gene RIF (121)

AA Sequence

MFINIKSILWMCSTLIVTHALHKVKVGKSPPVRGSLSGKVSLPCHFSTMPTLPPSYNTSEFLRIKWSKIE      1 - 70
VDKNGKDLKETTVLVAQNGNIKIGQDYKGRVSVPTHPEAVGDASLTVVKLLASDAGLYRCDVMYGIEDTQ     71 - 140
DTVSLTVDGVVFHYRAATSRYTLNFEAAQKACLDVGAVIATPEQLFAAYEDGFEQCDAGWLADQTVRYPI    141 - 210
RAPRVGCYGDKMGKAGVRTYGFRSPQETYDVYCYVDHLDGDVFHLTVPSKFTFEEAAKECENQDARLATV    211 - 280
GELQAAWRNGFDQCDYGWLSDASVRHPVTVARAQCGGGLLGVRTLYRFENQTGFPPPDSRFDAYCFKPKE    281 - 350
ATTIDLSILAETASPSLSKEPQMVSDRTTPIIPLVDELPVIPTEFPPVGNIVSFEQKATVQPQAITDSLA    351 - 420
TKLPTPTGSTKKPWDMDDYSPSASGPLGKLDISEIKEEVLQSTTGVSHYATDSWDGVVEDKQTQESVTQI    421 - 490
EQIEVGPLVTSMEILKHIPSKEFPVTETPLVTARMILESKTEKKMVSTVSELVTTGHYGFTLGEEDDEDR    491 - 560
TLTVGSDESTLIFDQIPEVITVSKTSEDTIHTHLEDLESVSASTTVSPLIMPDNNGSSMDDWEERQTSGR    561 - 630
ITEEFLGKYLSTTPFPSQHRTEIELFPYSGDKILVEGISTVIYPSLQTEMTHRRERTETLIPEMRTDTYT    631 - 700
DEIQEEITKSPFMGKTEEEVFSGMKLSTSLSEPIHVTESSVEMTKSFDFPTLITKLSAEPTEVRDMEEDF    701 - 770
TATPGTTKYDENITTVLLAHGTLSVEAATVSKWSWDEDNTTSKPLESTEPSASSKLPPALLTTVGMNGKD    771 - 840
KDIPSFTEDGADEFTLIPDSTQKQLEEVTDEDIAAHGKFTIRFQPTTSTGIAEKSTLRDSTTEEKVPPIT    841 - 910
STEGQVYATMEGSALGEVEDVDLSKPVSTVPQFAHTSEVEGLAFVSYSSTQEPTTYVDSSHTIPLSVIPK    911 - 980
TDWGVLVPSVPSEDEVLGEPSQDILVIDQTRLEATISPETMRTTKITEGTTQEEFPWKEQTAEKPVPALS    981 - 1050
STAWTPKEAVTPLDEQEGDGSAYTVSEDELLTGSERVPVLETTPVGKIDHSVSYPPGAVTEHKVKTDEVV   1051 - 1120
TLTPRIGPKVSLSPGPEQKYETEGSSTTGFTSSLSPFSTHITQLMEETTTEKTSLEDIDLGSGLFEKPKA   1121 - 1190
TELIEFSTIKVTVPSDITTAFSSVDRLHTTSAFKPSSAITKKPPLIDREPGEETTSDMVIIGESTSHVPP   1191 - 1260
TTLEDIVAKETETDIDREYFTTSSPPATQPTRPPTVEDKEAFGPQALSTPQPPASTKFHPDINVYIIEVR   1261 - 1330
ENKTGRMSDLSVIGHPIDSESKEDEPCSEETDPVHDLMAEILPEFPDIIEIDLYHSEENEEEEEECANAT   1331 - 1400
DVTTTPSVQYINGKHLVTTVPKDPEAAEARRGQFESVAPSQNFSDSSESDTHPFVIAKTELSTAVQPNES   1401 - 1470
TETTESLEVTWKPETYPETSEHFSGGEPDVFPTVPFHEEFESGTAKKGAESVTERDTEVGHQAHEHTEPV   1471 - 1540
SLFPEESSGEIAIDQESQKIAFARATEVTFGEEVEKSTSVTYTPTIVPSSASAYVSEEEAVTLIGNPWPD   1541 - 1610
DLLSTKESWVEATPRQVVELSGSSSIPITEGSGEAEEDEDTMFTMVTDLSQRNTTDTLITLDTSRIITES   1611 - 1680
FFEVPATTIYPVSEQPSAKVVPTKFVSETDTSEWISSTTVEEKKRKEEEGTTGTASTFEVYSSTQRSDQL   1681 - 1750
ILPFELESPNVATSSDSGTRKSFMSLTTPTQSEREMTDSTPVFTETNTLENLGAQTTEHSSIHQPGVQEG   1751 - 1820
LTTLPRSPASVFMEQGSGEAAADPETTTVSSFSLNVEYAIQAEKEVAGTLSPHVETTFSTEPTGLVLSTV   1821 - 1890
MDRVVAENITQTSREIVISERLGEPNYGAEIRGFSTGFPLEEDFSGDFREYSTVSHPIAKEETVMMEGSG   1891 - 1960
DAAFRDTQTSPSTVPTSVHISHISDSEGPSSTMVSTSAFPWEEFTSSAEGSGEQLVTVSSSVVPVLPSAV   1961 - 2030
QKFSGTASSIIDEGLGEVGTVNEIDRRSTILPTAEVEGTKAPVEKEEVKVSGTVSTNFPQTIEPAKLWSR   2031 - 2100
QEVNPVRQEIESETTSEEQIQEEKSFESPQNSPATEQTIFDSQTFTETELKTTDYSVLTTKKTYSDDKEM   2101 - 2170
KEEDTSLVNMSTPDPDANGLESYTTLPEATEKSHFFLATALVTESIPAEHVVTDSPIKKEESTKHFPKGM   2171 - 2240
RPTIQESDTELLFSGLGSGEEVLPTLPTESVNFTEVEQINNTLYPHTSQVESTSSDKIEDFNRMENVAKE   2241 - 2310
VGPLVSQTDIFEGSGSVTSTTLIEILSDTGAEGPTVAPLPFSTDIGHPQNQTVRWAEEIQTSRPQTITEQ   2311 - 2380
DSNKNSSTAEINETTTSSTDFLARAYGFEMAKEFVTSAPKPSDLYYEPSGEGSGEVDIVDSFHTSATTQA   2381 - 2450
TRQESSTTFVSDGSLEKHPEVPSAKAVTADGFPTVSVMLPLHSEQNKSSPDPTSTLSNTVSYERSTDGSF   2451 - 2520
QDRFREFEDSTLKPNRKKPTENIIIDLDKEDKDLILTITESTILEILPELTSDKNTIIDIDHTKPVYEDI   2521 - 2590
LGMQTDIDTEVPSEPHDSNDESNDDSTQVQEIYEAAVNLSLTEETFEGSADVLASYTQATHDESMTYEDR   2591 - 2660
SQLDHMGFHFTTGIPAPSTETELDVLLPTATSLPIPRKSATVIPEIEGIKAEAKALDDMFESSTLSDGQA   2661 - 2730
IADQSEIIPTLGQFERTQEEYEDKKHAGPSFQPEFSSGAEEALVDHTPYLSIATTHLMDQSVTEVPDVME   2731 - 2800
GSNPPYYTDTTLAVSTFAKLSSQTPSSPLTIYSGSEASGHTEIPQPSALPGIDVGSSVMSPQDSFKEIHV   2801 - 2870
NIEATFKPSSEEYLHITEPPSLSPDTKLEPSEDDGKPELLEEMEASPTELIAVEGTEILQDFQNKTDGQV   2871 - 2940
SGEAIKMFPTIKTPEAGTVITTADEIELEGATQWPHSTSASATYGVEAGVVPWLSPQTSERPTLSSSPEI   2941 - 3010
NPETQAALIRGQDSTIAASEQQVAARILDSNDQATVNPVEFNTEVATPPFSLLETSNETDFLIGINEESV   3011 - 3080
EGTAIYLPGPDRCKMNPCLNGGTCYPTETSYVCTCVPGYSGDQCELDFDECHSNPCRNGATCVDGFNTFR   3081 - 3150
CLCLPSYVGALCEQDTETCDYGWHKFQGQCYKYFAHRRTWDAAERECRLQGAHLTSILSHEEQMFVNRVG   3151 - 3220
HDYQWIGLNDKMFEHDFRWTDGSTLQYENWRPNQPDSFFSAGEDCVVIIWHENGQWNDVPCNYHLTYTCK   3221 - 3290
KGTVACGQPPVVENAKTFGKMKPRYEINSLIRYHCKDGFIQRHLPTIRCLGNGRWAIPKITCMNPSAYQR   3291 - 3360
TYSMKYFKNSSSAKDNSINTSKHDHRWSRRWQESRR                                     3361 - 3396
//

Text Mined References (162)

PMID Year Title