Property Summary

NCBI Gene PubMed Count 277
PubMed Score 3930.70
PubTator Score 2790.29

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Abortion, Spontaneous 109 0.0 0.0
Neoplasm Invasiveness 161 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Liver cancer 604 0.0 0.5
Disease Target Count Z-score Confidence
Alzheimer's disease 658 0.0 0.7

Expression

  Differential Expression (28)

Disease log2 FC p
adult high grade glioma -1.400 2.6e-02
astrocytic glioma 1.800 5.1e-03
Astrocytoma, Pilocytic 1.200 1.8e-02
atypical teratoid / rhabdoid tumor -3.200 9.8e-04
Breast cancer -2.700 4.1e-24
colon cancer -1.100 1.6e-03
Down syndrome 1.600 8.6e-04
ductal carcinoma in situ -1.400 3.0e-04
ependymoma 1.600 1.3e-02
gastric cancer 1.100 1.6e-02
glioblastoma -1.600 7.3e-04
group 3 medulloblastoma -2.000 1.2e-04
interstitial lung disease 1.300 4.0e-02
intraductal papillary-mucinous adenoma (... -1.400 2.6e-04
intraductal papillary-mucinous neoplasm ... -1.300 5.0e-03
invasive ductal carcinoma -1.400 2.0e-03
lung cancer -1.200 2.0e-02
lung carcinoma 3.600 1.0e-40
malignant mesothelioma 1.700 5.6e-05
medulloblastoma, large-cell -1.200 4.8e-05
oligodendroglioma 2.300 2.0e-03
osteosarcoma 1.477 1.2e-03
pituitary cancer 1.100 6.7e-06
primitive neuroectodermal tumor -2.000 3.6e-05
psoriasis -1.700 9.2e-77
subependymal giant cell astrocytoma -2.715 3.7e-03
tuberculosis 2.000 2.4e-05
type I diabetes mellitus -1.040 3.6e-02

Protein-protein Interaction (3)

Gene RIF (246)

AA Sequence

MLQTKDLIWTLFFLGTAVSLQVDIVPSQGEISVGESKFFLCQVAGDAKDKDISWFSPNGEKLTPNQQRIS      1 - 70
VVWNDDSSSTLTIYNANIDDAGIYKCVVTGEDGSESEATVNVKIFQKLMFKNAPTPQEFREGEDAVIVCD     71 - 140
VVSSLPPTIIWKHKGRDVILKKDVRFIVLSNNYLQIRGIKKTDEGTYRCEGRILARGEINFKDIQVIVNV    141 - 210
PPTIQARQNIVNATANLGQSVTLVCDAEGFPEPTMSWTKDGEQIEQEEDDEKYIFSDDSSQLTIKKVDKN    211 - 280
DEAEYICIAENKAGEQDATIHLKVFAKPKITYVENQTAMELEEQVTLTCEASGDPIPSITWRTSTRNISS    281 - 350
EEKASWTRPEKQETLDGHMVVRSHARVSSLTLKSIQYTDAGEYICTASNTIGQDSQSMYLEVQYAPKLQG    351 - 420
PVAVYTWEGNQVNITCEVFAYPSATISWFRDGQLLPSSNYSNIKIYNTPSASYLEVTPDSENDFGNYNCT    421 - 490
AVNRIGQESLEFILVQADTPSSPSIDQVEPYSSTAQVQFDEPEATGGVPILKYKAEWRAVGEEVWHSKWY    491 - 560
DAKEASMEGIVTIVGLKPETTYAVRLAALNGKGLGEISAASEFKTQPVQGEPSAPKLEGQMGEDGNSIKV    561 - 630
NLIKQDDGGSPIRHYLVRYRALSSEWKPEIRLPSGSDHVMLKSLDWNAEYEVYVVAENQQGKSKAAHFVF    631 - 700
RTSAQPTAIPANGSPTSGLSTGAIVGILIVIFVLLLVVVDITCYFLNKCGLFMCIAVNLCGKAGPGAKGK    701 - 770
DMEEGKAAFSKDESKEPIVEVRTEEERTPNHDGGKHTEPNETTPLTEPEKGPVEAKPECQETETKPAPAE    771 - 840
VKTVPNDATQTKENESKA                                                        841 - 858
//

Text Mined References (280)

PMID Year Title