Property Summary

NCBI Gene PubMed Count 259
Grant Count 302
R01 Count 187
Funding $35,278,766.07
PubMed Score 3805.81
PubTator Score 2790.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (28)

Disease log2 FC p
gastric carcinoma -1.500 0.041
interstitial lung disease 1.300 0.040
malignant mesothelioma 1.700 0.000
astrocytic glioma 1.800 0.005
ependymoma 1.600 0.013
oligodendroglioma 2.300 0.002
glioblastoma -1.600 0.001
osteosarcoma 1.477 0.001
group 3 medulloblastoma -3.400 0.000
atypical teratoid/rhabdoid tumor -3.500 0.000
medulloblastoma, large-cell -2.900 0.000
primitive neuroectodermal tumor -2.000 0.000
tuberculosis 2.000 0.000
intraductal papillary-mucinous adenoma (... -1.400 0.000
intraductal papillary-mucinous neoplasm ... -1.300 0.005
colon cancer -3.100 0.000
lung cancer -1.200 0.020
pediatric high grade glioma -1.500 0.010
pilocytic astrocytoma 1.200 0.018
subependymal giant cell astrocytoma -2.874 0.007
lung carcinoma 3.600 0.000
Breast cancer -2.700 0.000
ductal carcinoma in situ -1.400 0.000
invasive ductal carcinoma -1.400 0.002
pituitary cancer 1.300 0.000
Down syndrome 2.000 0.000
type I diabetes mellitus -1.040 0.036
psoriasis -1.700 0.000

Synonym

Gene

PDB

2E3V   2HAZ   2VKW   2VKX   3MTR   5AEA   5LKN  

Gene RIF (229)

PMID Text
26856773 NK cell maturation to CD56(dim) subset associated with high levels of NCRs overrides the inhibitory effect of NKG2A and recovers impaired NK cell cytolytic potential after allogeneic hematopoietic stem cell transplantation.
26694817 The expression of coding and non-coding genes with SAFB1 cross-link sites was altered by SAFB1 knockdown. The isoform-specific expression of neural cell adhesion molecule (NCAM1) and ASTN2 was influenced by SAFB1.
26597998 study demonstrated the prognostic value of CD56 and CD117 in patients with newly diagnosed MM patients. Absence of both of them was associated with the poorest prognosis
26503236 Galectin 3 is most sensitive marker for malignancy, while loss of expression of CD56 is very specific for malignancy
26478212 L1-CAM and N-CAM: From Adhesion Proteins to Pharmacological Targets
26463893 NCAM1 deletion is associated with neuroblastoma and ganglioneuroma.
26460482 The neural cell adhesion molecule (NCAM) is a glycoprotein implicated in cell-cell adhesion, neurite outgrowth and synaptic plasticity.
26437631 A FOXP3(+)CD3(+)CD56(+)-expressed T-cell population with immunosuppressive function and reduced patient survival has been identified in cancer tissues of human hepatocellular carcinoma.
26391771 Letter/Case Report: CD56 positive diffuse large B cell lymphoma of the urinary bladder.
26344352 the expression of CD56 in adenomyosis is positively associated with the severity of dysmenorrhea.
More...

AA Sequence

MLQTKDLIWTLFFLGTAVSLQVDIVPSQGEISVGESKFFLCQVAGDAKDKDISWFSPNGEKLTPNQQRIS      1 - 70
VVWNDDSSSTLTIYNANIDDAGIYKCVVTGEDGSESEATVNVKIFQKLMFKNAPTPQEFREGEDAVIVCD     71 - 140
VVSSLPPTIIWKHKGRDVILKKDVRFIVLSNNYLQIRGIKKTDEGTYRCEGRILARGEINFKDIQVIVNV    141 - 210
PPTIQARQNIVNATANLGQSVTLVCDAEGFPEPTMSWTKDGEQIEQEEDDEKYIFSDDSSQLTIKKVDKN    211 - 280
DEAEYICIAENKAGEQDATIHLKVFAKPKITYVENQTAMELEEQVTLTCEASGDPIPSITWRTSTRNISS    281 - 350
EEKASWTRPEKQETLDGHMVVRSHARVSSLTLKSIQYTDAGEYICTASNTIGQDSQSMYLEVQYAPKLQG    351 - 420
PVAVYTWEGNQVNITCEVFAYPSATISWFRDGQLLPSSNYSNIKIYNTPSASYLEVTPDSENDFGNYNCT    421 - 490
AVNRIGQESLEFILVQADTPSSPSIDQVEPYSSTAQVQFDEPEATGGVPILKYKAEWRAVGEEVWHSKWY    491 - 560
DAKEASMEGIVTIVGLKPETTYAVRLAALNGKGLGEISAASEFKTQPVQGEPSAPKLEGQMGEDGNSIKV    561 - 630
NLIKQDDGGSPIRHYLVRYRALSSEWKPEIRLPSGSDHVMLKSLDWNAEYEVYVVAENQQGKSKAAHFVF    631 - 700
RTSAQPTAIPANGSPTSGLSTGAIVGILIVIFVLLLVVVDITCYFLNKCGLFMCIAVNLCGKAGPGAKGK    701 - 770
DMEEGKAAFSKDESKEPIVEVRTEEERTPNHDGGKHTEPNETTPLTEPEKGPVEAKPECQETETKPAPAE    771 - 840
VKTVPNDATQTKENESKA                                                        841 - 858
//

Text Mined References (262)

PMID Year Title
26856773 2016 NK cell maturation to CD56(dim) subset associated with high levels of NCRs overrides the inhibitory effect of NKG2A and recovers impaired NK cell cytolytic potential after allogeneic hematopoietic stem cell transplantation.
26694817 2015 iCLIP identifies novel roles for SAFB1 in regulating RNA processing and neuronal function.
26597998 2016 Absence of both CD56 and CD117 expression on malignant plasma cells is related with a poor prognosis in patients with newly diagnosed multiple myeloma.
26503236 2015 Defining the value of CD56, CK19, Galectin 3 and HBME-1 in diagnosis of follicular cell derived lesions of thyroid with systematic review of literature.
26478212 2015 L1-CAM and N-CAM: From Adhesion Proteins to Pharmacological Targets.
26463893 2016 Coexistence of neuroblastoma and ganglioneuroma in a girl with a hemizygous deletion of chromosome 11q14.1-23.3.
26460482 2015 Brain structure, cognition and negative symptoms in schizophrenia are associated with serum levels of polysialic acid-modified NCAM.
26437631 2015 Identification of a FOXP3(+)CD3(+)CD56(+) population with immunosuppressive function in cancer tissues of human hepatocellular carcinoma.
26391771 2016 Neural cell adhesion molecule (CD56)-positive B cell lymphoma of the urinary bladder.
26344352 2015 Expression of CD56 in patients with adenomyosis and its correlation with dysmenorrhea.
More...