Property Summary

NCBI Gene PubMed Count 37
PubMed Score 66.87
PubTator Score 40.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adrenocortical adenoma -1.820 4.0e-03
adrenocortical carcinoma -2.715 1.1e-16
chronic rhinosinusitis -1.886 3.2e-02
ductal carcinoma in situ -1.300 1.3e-02
Endometriosis -2.637 7.3e-03
esophageal adenocarcinoma -3.400 1.8e-02
interstitial cystitis -2.500 3.1e-02
lung adenocarcinoma -2.000 6.9e-07
lung cancer -6.000 1.6e-06
lung carcinoma -4.700 8.3e-38
nasopharyngeal carcinoma -1.400 2.0e-06
non-small cell lung cancer -4.098 6.7e-26
osteosarcoma 1.752 1.8e-05
pituitary cancer -1.800 2.4e-07
posterior fossa group B ependymoma 1.300 7.7e-03
psoriasis -1.900 1.3e-04

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (16)

AA Sequence

MVPSFLSLSFSSLGLWASGLILVLGFLKLIHLLLRRQTLAKAMDKFPGPPTHWLFGHALEIQETGSLDKV      1 - 70
VSWAHQFPYAHPLWFGQFIGFLNIYEPDYAKAVYSRGDPKAPDVYDFFLQWIGRGLLVLEGPKWLQHRKL     71 - 140
LTPGFHYDVLKPYVAVFTESTRIMLDKWEEKAREGKSFDIFCDVGHMALNTLMKCTFGRGDTGLGHRDSS    141 - 210
YYLAVSDLTLLMQQRLVSFQYHNDFIYWLTPHGRRFLRACQVAHDHTDQVIRERKAALQDEKVRKKIQNR    211 - 280
RHLDFLDILLGARDEDDIKLSDADLRAEVDTFMFEGHDTTTSGISWFLYCMALYPEHQHRCREEVREILG    281 - 350
DQDFFQWDDLGKMTYLTMCIKESFRLYPPVPQVYRQLSKPVTFVDGRSLPAGSLISMHIYALHRNSAVWP    351 - 420
DPEVFDSLRFSTENASKRHPFAFMPFSAGPRNCIGQQFAMSEMKVVTAMCLLRFEFSLDPSRLPIKMPQL    421 - 490
VLRSKNGFHLHLKPLGPGSGK                                                     491 - 511
//

Text Mined References (40)

PMID Year Title