Property Summary

NCBI Gene PubMed Count 37
Grant Count 25
R01 Count 25
Funding $3,059,972
PubMed Score 65.43
PubTator Score 40.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
esophageal adenocarcinoma -3.400 0.018
psoriasis -1.900 0.000
osteosarcoma 1.752 0.000
adrenocortical adenoma -1.820 0.004
adrenocortical carcinoma -2.715 0.000
non-small cell lung cancer -5.268 0.000
lung cancer -7.800 0.000
interstitial cystitis -4.900 0.002
lung adenocarcinoma -3.000 0.000
posterior fossa group B ependymoma 1.300 0.008
nasopharyngeal carcinoma -3.300 0.000
Endometriosis -2.637 0.007
lung carcinoma -4.700 0.000
ductal carcinoma in situ -2.500 0.017
pituitary cancer -3.500 0.000
chronic rhinosinusitis -1.904 0.029

 GWAS Trait (1)

Gene RIF (16)

PMID Text
26355749 the Ser207 insertion does not rescue the P450 functional activity of human CYP4B1 that has been lost during evolution.
26252103 Single nucleotide polymorphisms of CYP2C8,CYP2E1 and CYP4B1 are associated with susceptibility to gout in ethnic Han males population.
25247810 A proline residue in the meander region at position 427 in human CYP4B1 and 422 in rabbit CYP4B1 is important for protein stability and rescues the 4-ipomeanol bioactivation.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19898482 Observational study of gene-disease association. (HuGE Navigator)
19343046 Observational study of gene-disease association. (HuGE Navigator)
19074885 Observational study of gene-disease association. (HuGE Navigator)
19040121 Detected by polymerase chain reaction in prostate tissue.
More...

AA Sequence

MVPSFLSLSFSSLGLWASGLILVLGFLKLIHLLLRRQTLAKAMDKFPGPPTHWLFGHALEIQETGSLDKV      1 - 70
VSWAHQFPYAHPLWFGQFIGFLNIYEPDYAKAVYSRGDPKAPDVYDFFLQWIGRGLLVLEGPKWLQHRKL     71 - 140
LTPGFHYDVLKPYVAVFTESTRIMLDKWEEKAREGKSFDIFCDVGHMALNTLMKCTFGRGDTGLGHRDSS    141 - 210
YYLAVSDLTLLMQQRLVSFQYHNDFIYWLTPHGRRFLRACQVAHDHTDQVIRERKAALQDEKVRKKIQNR    211 - 280
RHLDFLDILLGARDEDDIKLSDADLRAEVDTFMFEGHDTTTSGISWFLYCMALYPEHQHRCREEVREILG    281 - 350
DQDFFQWDDLGKMTYLTMCIKESFRLYPPVPQVYRQLSKPVTFVDGRSLPAGSLISMHIYALHRNSAVWP    351 - 420
DPEVFDSLRFSTENASKRHPFAFMPFSAGPRNCIGQQFAMSEMKVVTAMCLLRFEFSLDPSRLPIKMPQL    421 - 490
VLRSKNGFHLHLKPLGPGSGK                                                     491 - 511
//

Text Mined References (40)

PMID Year Title
26355749 2015 Characterization of an Additional Splice Acceptor Site Introduced into CYP4B1 in Hominoidae during Evolution.
26252103 2015 [Association of single nucleotide polymorphisms of cytochrome P450 gene with susceptibility to gout in ethnic Han males from coastal regions of Shandong province].
25247810 2015 Identification of amino acid determinants in CYP4B1 for optimal catalytic processing of 4-ipomeanol.
22675492 2012 Genome-wide association study of circulating estradiol, testosterone, and sex hormone-binding globulin in postmenopausal women.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19898482 2009 Genetic variants in TPMT and COMT are associated with hearing loss in children receiving cisplatin chemotherapy.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
19074885 2008 Genetic variants in apoptosis and immunoregulation-related genes are associated with risk of chronic lymphocytic leukemia.
More...