Property Summary

Ligand Count 178
NCBI Gene PubMed Count 1,461
PubMed Score 6397.44
PubTator Score 5925.49

Knowledge Summary

Patent (256,277)

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.2
Kidney cancer 2613 0.0 0.7
Melanoma 711 0.0 0.5
Skin cancer 469 0.0 0.6

Expression

  Differential Expression (14)

Disease log2 FC p
cutaneous lupus erythematosus -1.600 2.3e-02
esophageal adenocarcinoma 1.200 2.6e-02
intraductal papillary-mucinous adenoma (... -1.400 2.9e-02
intraductal papillary-mucinous carcinoma... -3.400 1.2e-02
intraductal papillary-mucinous neoplasm ... -1.600 2.4e-02
lung adenocarcinoma -1.600 2.2e-08
lung cancer -2.600 3.0e-05
lung carcinoma -1.300 4.6e-06
malignant mesothelioma 1.200 1.0e-04
non primary Sjogren syndrome sicca -1.400 2.0e-02
non-small cell lung cancer -1.684 3.1e-12
pancreatic cancer -1.200 5.0e-02
psoriasis -1.700 3.1e-04
ulcerative colitis -1.300 1.7e-03

Protein-protein Interaction (1)

Gene RIF (1454)

AA Sequence

MQRSPLEKASVVSKLFFSWTRPILRKGYRQRLELSDIYQIPSVDSADNLSEKLEREWDRELASKKNPKLI      1 - 70
NALRRCFFWRFMFYGIFLYLGEVTKAVQPLLLGRIIASYDPDNKEERSIAIYLGIGLCLLFIVRTLLLHP     71 - 140
AIFGLHHIGMQMRIAMFSLIYKKTLKLSSRVLDKISIGQLVSLLSNNLNKFDEGLALAHFVWIAPLQVAL    141 - 210
LMGLIWELLQASAFCGLGFLIVLALFQAGLGRMMMKYRDQRAGKISERLVITSEMIENIQSVKAYCWEEA    211 - 280
MEKMIENLRQTELKLTRKAAYVRYFNSSAFFFSGFFVVFLSVLPYALIKGIILRKIFTTISFCIVLRMAV    281 - 350
TRQFPWAVQTWYDSLGAINKIQDFLQKQEYKTLEYNLTTTEVVMENVTAFWEEGFGELFEKAKQNNNNRK    351 - 420
TSNGDDSLFFSNFSLLGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMVIMGELEPSEGKIKHSGRISF    421 - 490
CSQFSWIMPGTIKENIIFGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEGGITLSGGQRARISLAR    491 - 560
AVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTF    561 - 630
SELQNLQPDFSSKLMGCDSFDQFSAERRNSILTETLHRFSLEGDAPVSWTETKKQSFKQTGEFGEKRKNS    631 - 700
ILNPINSIRKFSIVQKTPLQMNGIEEDSDEPLERRLSLVPDSEQGEAILPRISVISTGPTLQARRRQSVL    701 - 770
NLMTHSVNQGQNIHRKTTASTRKVSLAPQANLTELDIYSRRLSQETGLEISEEINEEDLKECFFDDMESI    771 - 840
PAVTTWNTYLRYITVHKSLIFVLIWCLVIFLAEVAASLVVLWLLGNTPLQDKGNSTHSRNNSYAVIITST    841 - 910
SSYYVFYIYVGVADTLLAMGFFRGLPLVHTLITVSKILHHKMLHSVLQAPMSTLNTLKAGGILNRFSKDI    911 - 980
AILDDLLPLTIFDFIQLLLIVIGAIAVVAVLQPYIFVATVPVIVAFIMLRAYFLQTSQQLKQLESEGRSP    981 - 1050
IFTHLVTSLKGLWTLRAFGRQPYFETLFHKALNLHTANWFLYLSTLRWFQMRIEMIFVIFFIAVTFISIL   1051 - 1120
TTGEGEGRVGIILTLAMNIMSTLQWAVNSSIDVDSLMRSVSRVFKFIDMPTEGKPTKSTKPYKNGQLSKV   1121 - 1190
MIIENSHVKKDDIWPSGGQMTVKDLTAKYTEGGNAILENISFSISPGQRVGLLGRTGSGKSTLLSAFLRL   1191 - 1260
LNTEGEIQIDGVSWDSITLQQWRKAFGVIPQKVFIFSGTFRKNLDPYEQWSDQEIWKVADEVGLRSVIEQ   1261 - 1330
FPGKLDFVLVDGGCVLSHGHKQLMCLARSVLSKAKILLLDEPSAHLDPVTYQIIRRTLKQAFADCTVILC   1331 - 1400
EHRIEAMLECQQFLVIEENKVRQYDSIQKLLNERSLFRQAISPSDRVKLFPHRNSSKCKSKPQIAALKEE   1401 - 1470
TEEEVQDTRL                                                               1471 - 1480
//

Text Mined References (1483)

PMID Year Title