Property Summary

NCBI Gene PubMed Count 42
PubMed Score 283.36
PubTator Score 128.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adrenocortical adenoma -2.129 1.5e-02
aldosterone-producing adenoma -3.937 1.1e-02
Alzheimer's disease -1.700 3.1e-02
astrocytic glioma -1.800 3.0e-02
colon cancer -1.800 1.9e-03
ductal carcinoma in situ 1.400 8.1e-03
ependymoma -1.300 2.9e-02
facioscapulohumeral dystrophy -1.700 8.0e-03
group 4 medulloblastoma -1.800 2.2e-02
head and neck cancer and chronic obstruc... -1.200 3.7e-02
intraductal papillary-mucinous carcinoma... -2.100 3.1e-02
lung cancer 3.100 5.3e-04
lung carcinoma 6.700 1.6e-71
malignant mesothelioma -1.100 5.6e-06
medulloblastoma, large-cell -2.800 9.4e-03
ovarian cancer 3.000 5.7e-04
Pick disease -1.800 2.1e-02

Gene RIF (20)

AA Sequence

MAEAKTHWLGAALSLIPLIFLISGAEAASFQRNQLLQKEPDLRLENVQKFPSPEMIRALEYIENLRQQAH      1 - 70
KEESSPDYNPYQGVSVPLQQKENGDESHLPERDSLSEEDWMRIILEALRQAENEPQSAPKENKPYALNSE     71 - 140
KNFPMDMSDDYETQQWPERKLKHMQFPPMYEENSRDNPFKRTNEIVEEQYTPQSLATLESVFQELGKLTG    141 - 210
PNNQKRERMDEEQKLYTDDEDDIYKANNIAYEDVVGGEDWNPVEEKIESQTQEEVRDSKENIEKNEQIND    211 - 280
EMKRSGQLGIQEEDLRKESKDQLSDDVSKVIAYLKRLVNAAGSGRLQNGQNGERATRLFEKPLDSQSIYQ    281 - 350
LIEISRNLQIPPEDLIEMLKTGEKPNGSVEPERELDLPVDLDDISEADLDHPDLFQNRMLSKSGYPKTPG    351 - 420
RAGTEALPDGLSVEDILNLLGMESAANQKTSYFPNPYNQEKVLPRLPYGAGRSRSNQLPKAAWIPHVENR    421 - 490
QMAYENLNDKDQELGEYLARMLVKYPEIINSNQVKRVPGQGSSEDDLQEEEQIEQAIKEHLNQGSSQETD    491 - 560
KLAPVSKRFPVGPPKNDDTPNRQYWDEDLLMKVLEYLNQEKAEKGREHIAKRAMENM                 561 - 617
//

Text Mined References (44)

PMID Year Title