Property Summary

NCBI Gene PubMed Count 41
Grant Count 27
R01 Count 15
Funding $1,998,438.82
PubMed Score 273.44
PubTator Score 128.25

Knowledge Summary

Patent

No data available

Expression

Gene RIF (20)

PMID Text
26378181 Differential Reovirus-Specific and Herpesvirus-Specific Activator Protein 1 Activation of Secretogranin II Leads to Altered Virus Secretion.
25307750 present data show that SgII is highly expressed in advanced prostate cancer and may contribute to the neuroendocrine differentiation by promoting the formation of secretory granules and the proliferation of PCa cells.
24667918 Microarray analysis indicates HIV-1 Tat-induced upregulation of secretogranin II (SCG2) in primary human brain microvascular endothelial cells
24556756 SN induces MUC5AC hypersecretion in a dose- and time-dependent manner; moreover, the MUC5AC over synthesis induced by SN is strongly associated with the enhanced binding of EGF to NRP1
23918206 Topical secretoneurin gene therapy accelerates diabetic wound healing by interaction between heparan-sulfate proteoglycans and basic FGF.
23423580 CgA, CgB, and secretoneurin are detectable in feces, and collagenous colitis patients express higher values than patients with inflammatory bowel disease and controls. In treatment, fecal secretoneurin decreased to control levels in collagenous colitis.
23081990 In vivo secretoneurin improves left ventricular function, inhibits remodeling, and reduces scar formation; in the infarct border zone, secretoneurin induces coronary angiogenesis.
22655045 Circulating Levels of SgII are Increased in Patients with chronic, stable heart failure.
22217803 Data describe the gene expression and protein production of SgII in normal adrenal glands and pheochromocytomas with the goal to examine the molecular mechanisms leading to the marked variations in the expression of EM66 in tumoral chromaffin tissue.
21803620 Manserin may serve as a marker of prostate cancer progression.
More...

AA Sequence

MAEAKTHWLGAALSLIPLIFLISGAEAASFQRNQLLQKEPDLRLENVQKFPSPEMIRALEYIENLRQQAH      1 - 70
KEESSPDYNPYQGVSVPLQQKENGDESHLPERDSLSEEDWMRIILEALRQAENEPQSAPKENKPYALNSE     71 - 140
KNFPMDMSDDYETQQWPERKLKHMQFPPMYEENSRDNPFKRTNEIVEEQYTPQSLATLESVFQELGKLTG    141 - 210
PNNQKRERMDEEQKLYTDDEDDIYKANNIAYEDVVGGEDWNPVEEKIESQTQEEVRDSKENIEKNEQIND    211 - 280
EMKRSGQLGIQEEDLRKESKDQLSDDVSKVIAYLKRLVNAAGSGRLQNGQNGERATRLFEKPLDSQSIYQ    281 - 350
LIEISRNLQIPPEDLIEMLKTGEKPNGSVEPERELDLPVDLDDISEADLDHPDLFQNRMLSKSGYPKTPG    351 - 420
RAGTEALPDGLSVEDILNLLGMESAANQKTSYFPNPYNQEKVLPRLPYGAGRSRSNQLPKAAWIPHVENR    421 - 490
QMAYENLNDKDQELGEYLARMLVKYPEIINSNQVKRVPGQGSSEDDLQEEEQIEQAIKEHLNQGSSQETD    491 - 560
KLAPVSKRFPVGPPKNDDTPNRQYWDEDLLMKVLEYLNQEKAEKGREHIAKRAMENM                 561 - 617
//

Text Mined References (43)

PMID Year Title
26378181 2015 Differential Reovirus-Specific and Herpesvirus-Specific Activator Protein 1 Activation of Secretogranin II Leads to Altered Virus Secretion.
25416956 2014 A proteome-scale map of the human interactome network.
25307750 2014 Secretogranin II is overexpressed in advanced prostate cancer and promotes the neuroendocrine differentiation of prostate cancer cells.
24556756 2014 Secretoneurin induces airway mucus hypersecretion by enhancing the binding of EGF to NRP1.
23918206 2014 Topical secretoneurin gene therapy accelerates diabetic wound healing by interaction between heparan-sulfate proteoglycans and basic FGF.
23423580 2013 Increased fecal levels of chromogranin A, chromogranin B, and secretoneurin in collagenous colitis.
23234360 2013 LC-MS/MS characterization of O-glycosylation sites and glycan structures of human cerebrospinal fluid glycoproteins.
23081990 2012 The angiogenic factor secretoneurin induces coronary angiogenesis in a model of myocardial infarction by stimulation of vascular endothelial growth factor signaling in endothelial cells.
22655045 2012 Secretogranin II; a protein increased in the myocardium and circulation in heart failure with cardioprotective properties.
22217803 2012 Differential expression and processing of secretogranin II in relation to the status of pheochromocytoma: implications for the production of the tumoral marker EM66.
More...