Property Summary

Ligand Count 27
NCBI Gene PubMed Count 600
PubMed Score 2431.24
PubTator Score 1704.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (25)

Protein-protein Interaction (8)

Gene RIF (643)

AA Sequence

MKVSAAALAVILIATALCAPASASPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNR      1 - 70
QVCANPEKKWVREYINSLEMS                                                      71 - 91
//

Text Mined References (601)

PMID Year Title