Property Summary

NCBI Gene PubMed Count 560
Grant Count 784
R01 Count 378
Funding $81,402,018.26
PubMed Score 2314.54
PubTator Score 1704.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (58)

Disease Z-score Confidence
Asthma 349 5.759 2.9
Human immunodeficiency virus infectious ... 92  5.42 2.7
Eosinophilia 65 4.66 2.3
Lung disease 132 4.631 2.3
Cancer 2,346 4.499 2.2
Multiple Sclerosis 498 4.499 2.2
Arthritis 248 4.415 2.2
Dermatitis 107 4.361 2.2
Gastrointestinal system disease 50 4.334 2.2
Kidney disease 396 4.224 2.1
Atherosclerosis 275 4.222 2.1
Influenza 142 4.19 2.1
Encephalitis 54 4.152 2.1
Hypersensitivity reaction type II diseas... 235  4.051 2.0
Allergic hypersensitivity disease 123 3.842 1.9
Allergic rhinitis 91 3.788 1.9
Common cold 63 3.724 1.9
Endometriosis 535 3.681 1.8
tuberculosis 1,557 3.673 1.8
Uveitis 103 3.642 1.8
Meningoencephalitis 13 3.412 1.7
diabetes mellitus 1,663 3.282 1.6
Coronary artery disease 240 3.273 1.6
Meningitis 46 3.178 1.6
psoriasis 6,685 3.091 1.5
Severe acute respiratory syndrome 26 3.004 1.5
Biliary cirrhosis 33
Dermatitis, Atopic 45
Glomerulonephritis 36
Hepatitis, Alcoholic 2
Hepatitis, Autoimmune 17
Hyperoxaluria 5
Peripheral Neuropathy 303
Pulmonary Fibrosis 66
active Crohn's disease 918
acute myeloid leukemia 780
adult high grade glioma 2,148
atypical teratoid / rhabdoid tumor 4,369
cutaneous lupus erythematosus 1,056
cystic fibrosis 1,665
glioblastoma 5,572
interstitial cystitis 2,299
intraductal papillary-mucinous carcinoma... 2,988 
invasive ductal carcinoma 2,950
juvenile dermatomyositis 1,189
lung adenocarcinoma 2,713
lung cancer 4,466
lung carcinoma 2,844
malignant mesothelioma 3,162
mucosa-associated lymphoid tissue lympho... 480 
nasopharyngeal carcinoma 1,056
non-small cell lung cancer 2,798
ovarian cancer 8,484
posterior fossa group A ependymoma 1,511
primary Sjogren syndrome 789
primitive neuroectodermal tumor 3,031
sarcoidosis 358
subependymal giant cell astrocytoma 2,287

Expression

Synonym

Accession P13501 O43646 Q0QVW8 Q4ZGJ1 Q9NYA2 Q9UBG2 Q9UC99
Symbols SISd
eoCP
SCYA5
RANTES
TCP228
D17S136E
SIS-delta

Gene

PDB

1B3A   1EQT   1HRJ   1RTN   1RTO   1U4L   1U4M   1U4P   1U4R   2L9H   2VXW   5CMD   5COY   5DNF  

Gene RIF (608)

PMID Text
26790618 ERalpha decreased CCL5 and IL-6 expression in conditioned media that was collected from Cancer associated fibroblast cell.
26728495 This is the first study to note that elevated systemic CCL5 and CXCL6 were associated with moderate/severe lumbar disc degeneration. These chemokines may be systemic biomarkers for the diagnosis and monitoring of disc degeneration.
26699196 co-cultures of KYSE-410 cells and cancer-associated fibroblasts (CAF) were investigated. Similar to SF, Has2 and Ccl5 were up-regulated and Ccl11 was down-regulated in CAF in co-culture.
26659570 neutrophil-borne human neutrophil peptide 1 (HNP1, alpha-defensin) and platelet-derived CCL5 form heteromers.
26647394 CCL5 signaling through CCR5 may increase platelet counts during physiological stress.
26620981 findings demonstrated that CCL5 gene -28C>G polymorphism might be a protective factor for the development of TB
26585233 High CCL5 expression is associated with neurofibromatosis-1 Glioma.
26420723 CCL-5-mediated cancer cell migration and invasion are discussed in the context of intertwined feedback loops between breast cancer cells and stromal cells. [review]
26390883 Study provides the evidence that the chemokine receptor CCR5 is highly expressed and associated with poor prognosis in human glioblastoma. Mechanistically, CCL5-CCR5 mediates activation of Akt, and subsequently induces proliferation and invasive responses in U87 and U251 cells.
26363360 Nuclear beta-catenin localization is related to increased CCL5 production in breast cancer.
More...

AA Sequence

MKVSAAALAVILIATALCAPASASPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNR      1 - 70
QVCANPEKKWVREYINSLEMS                                                      71 - 91
//

Text Mined References (561)

PMID Year Title
26790618 2016 Estrogen receptor ? in cancer associated fibroblasts suppresses prostate cancer invasion via reducing CCL5, IL6 and macrophage infiltration in the tumor microenvironment.
26728495 2016 Systemic blood plasma CCL5 and CXCL6: Potential biomarkers for human lumbar disc degeneration.
26699196 2016 Esophageal Squamous Cell Carcinoma Cells Modulate Chemokine Expression and Hyaluronan Synthesis in Fibroblasts.
26659570 2015 Recruitment of classical monocytes can be inhibited by disturbing heteromers of neutrophil HNP1 and platelet CCL5.
26647394 2016 CCL5 derived from platelets increases megakaryocyte proplatelet formation.
26620981 2015 The association between the CC chemokine ligand 5 -28C>G gene polymorphism and tuberculosis susceptibility.
26585233 2015 RNA Sequencing of Tumor-Associated Microglia Reveals Ccl5 as a Stromal Chemokine Critical for Neurofibromatosis-1 Glioma Growth.
26420723 2015 Recent Advances in Discovering the Role of CCL5 in Metastatic Breast Cancer.
26390883 2015 Critical roles of chemokine receptor CCR5 in regulating glioblastoma proliferation and invasion.
26363360 2015 The ?-catenin signaling pathway induces aggressive potential in breast cancer by up-regulating the chemokine CCL5.
More...