Property Summary

NCBI Gene PubMed Count 103
Grant Count 56
R01 Count 32
Funding $5,048,741.49
PubMed Score 315.73
PubTator Score 262.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.125 0.045
Multiple myeloma 1.713 0.001
malignant mesothelioma -1.900 0.000
psoriasis 1.200 0.001
group 4 medulloblastoma -2.100 0.001
glioblastoma 1.600 0.007
medulloblastoma, large-cell -2.100 0.001
juvenile dermatomyositis 1.114 0.000
acute quadriplegic myopathy 1.083 0.000
tuberculosis 1.500 0.000
pancreatic ductal adenocarcinoma liver m... -2.105 0.008
lung cancer -1.900 0.006
pediatric high grade glioma 1.300 0.003
pilocytic astrocytoma 1.100 0.000
subependymal giant cell astrocytoma 1.940 0.027
ovarian cancer 2.000 0.001
Down syndrome 1.900 0.000
dermatomyositis 1.500 0.002

Synonym

Accession P13473 A8K4X5 D3DTF0 Q16641 Q6Q3G8 Q96J30 Q99534 Q9UD93 LAMP-2
Symbols LAMPB
CD107b
LAMP-2
LGP110

Gene

PDB

2MOF   2MOM  

 GO Function (1)

 OMIM Term (1)

Gene RIF (64)

PMID Text
26856698 LAMP-2C serves as a natural inhibitor of chaperone-mediated autophagy that can selectively skew MHCII presentation of cytoplasmic antigens
26658462 This study showed that LAMP2 upregulation occurs in vitro and in vivo in neoplastic cells.
26398689 In our study of the EOG in Danon disease, we show for the first time to our knowledge that a LAMP2 mutation may cause a primary retinal pigment epitheliopathy.
26350055 Up-regulation of LAMP2 is associated with carcinogenesis and progression of Salivary Adenoid Cystic Carcinoma.
26186441 HIV-1 Vpr reduces co-localization of LAMP2 colocalization with HIV-1 MA (p17) in monocyte-derived macropaphages
26186441 HIV-1 Vpr reduces co-localization of LAMP2 colocalization with HIV-1 MA (p17) in monocyte-derived macropaphages
25940285 Down-regulation of LAMP2A expression could inhibit cell proliferation in multiple myeloma cells
25653352 HIV-1 Vpr reduces co-localization of LAMP2 colocalization with HIV-1 MA (p17) in monocyte-derived macropaphages
25594542 In the early stages of Parkinson's disease, with LAMP2A selectively reduced in association with increased alpha-synuclein, and decreased levels of heat shock cognate protein 70.
25342746 Data show thart lysosome-associated membrane protein type 2a (LAMP-2A) forms a coiled coil helix trimer in n-dodecylphosphocholine micelle, and protein substrates interact with its cytosolic tail.
More...

AA Sequence

MVCFRLFPVPGSGLVLVCLVLGAVRSYALELNLTDSENATCLYAKWQMNFTVRYETTNKTYKTVTISDHG      1 - 70
TVTYNGSICGDDQNGPKIAVQFGPGFSWIANFTKAASTYSIDSVSFSYNTGDNTTFPDAEDKGILTVDEL     71 - 140
LAIRIPLNDLFRCNSLSTLEKNDVVQHYWDVLVQAFVQNGTVSTNEFLCDKDKTSTVAPTIHTTVPSPTT    141 - 210
TPTPKEKPEAGTYSVNNGNDTCLLATMGLQLNITQDKVASVININPNTTHSTGSCRSHTALLRLNSSTIK    211 - 280
YLDFVFAVKNENRFYLKEVNISMYLVNGSVFSIANNNLSYWDAPLGSSYMCNKEQTVSVSGAFQINTFDL    281 - 350
RVQPFNVTQGKYSTAQDCSADDDNFLVPIAVGAALAGVLILVLLAYFIGLKHHHAGYEQF              351 - 410
//

Text Mined References (109)

PMID Year Title
26856698 2016 LAMP-2C Inhibits MHC Class II Presentation of Cytoplasmic Antigens by Disrupting Chaperone-Mediated Autophagy.
26658462 2015 Chronic acidosis in the tumour microenvironment selects for overexpression of LAMP2 in the plasma membrane.
26398689 2016 THE PHYSIOLOGY OF THE RETINAL PIGMENT EPITHELIUM IN DANON DISEASE.
26350055 2016 Expression of LC3, LAMP2, KEAP1 and NRF2 in Salivary Adenoid Cystic Carcinoma.
26212789 2015 Chaperone-mediated autophagy prevents apoptosis by degrading BBC3/PUMA.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25940285 2015 [Lentivirus-mediated shRNA silencing of LAMP2A inhibits the proliferation of multiple myeloma cells].
25645918 2015 Human neutrophils secrete bioactive paucimannosidic proteins from azurophilic granules into pathogen-infected sputum.
25594542 2015 Lysosomal-associated membrane protein 2 isoforms are differentially affected in early Parkinson's disease.
25342746 2014 Structure of transmembrane domain of lysosome-associated membrane protein type 2a (LAMP-2A) reveals key features for substrate specificity in chaperone-mediated autophagy.
More...