Property Summary

NCBI Gene PubMed Count 80
PubMed Score 156.30
PubTator Score 75.14

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P13385 Q8TCC1
Symbols CR
CRGF
CRIPTO

Gene

PANTHER Protein Class (1)

Gene RIF (58)

PMID Text
26375669 Cripto-1 overexpression contributes to aggressiveness and poor prognosis of hepatocellular carcinoma
26343543 Cripto-1 is a novel and dynamically regulated effector of stem cell functions in colorectal cancer.
26327334 The main signaling pathways mediating Cripto-1 effects include Nodal-dependent (Smad2/3) and Nodal-independent (Src/p44/42/Akt) signaling transduction pathways
26109366 serum CR-1 is a useful diagnostic and prognostic marker for nonsmall cell lung cancer patients.
25889638 Snail represses Cripto-1 gene by direct transcriptional interaction
25796148 Over expression of Cripto-1 was correlated with the occurrence, development, metastasis and malignant degree of lung adenocarcinoma.
25658584 Treatment of U-87 MG cells with CR-1 leads to higher expression of drug efflux protein MDR-1 in the CR-1 positive subpopulation, indicating correlated induction of these two proteins.
25629528 the functional analysis of the main associated locus identified a causal variant in the 5'UTR of CRIPTO gene which is able to strongly modulate CRIPTO expression through an AP-1-mediate transcriptional regulation.
25596738 these findings suggest a novel molecular network, involving CRIPTO, AKT, and FGFR signaling, in favor of the emergence of mesenchymal-like cancer cells during the development of aggressive prostate tumors.
25326807 Our findings suggest that high Cripto-1 expression might be involved in the development of bladder cancer and a potentially effective prognostic marker in bladder cancer patients
More...

AA Sequence

MDCRKMARFSYSVIWIMAISKVFELGLVAGLGHQEFARPSRGYLAFRDDSIWPQEEPAIRPRSSQRVPPM      1 - 70
GIQHSKELNRTCCLNGGTCMLGSFCACPPSFYGRNCEHDVRKENCGSVPHDTWLPKKCSLCKCWHGQLRC     71 - 140
FPQAFLPGCDGLVMDEHLVASRTPELPPSARTTTFMLVGICLSIQSYY                          141 - 188
//

Text Mined References (83)

PMID Year Title
26375669 2015 Elevated expression of Cripto-1 correlates with poor prognosis in hepatocellular carcinoma.
26343543 2015 Dynamic regulation of the cancer stem cell compartment by Cripto-1 in colorectal cancer.
26327334 2015 Cripto-1: an extracellular protein - connecting the sequestered biological dots.
26109366 2015 Serum cripto-1 as a clinical marker for lung cancer.
25889638 2015 Snail-mediated Cripto-1 repression regulates the cell cycle and epithelial-mesenchymal transition-related gene expression.
25796148 2015 Expression of Cripto-1 gene protein and Activin-A in human lung adenocarcinoma tissue.
25658584 2015 Autoregulation and heterogeneity in expression of human Cripto-1.
25629528 2015 Genetic variants modulating CRIPTO serum levels identified by genome-wide association study in Cilento isolates.
25596738 2015 CRIPTO overexpression promotes mesenchymal differentiation in prostate carcinoma cells through parallel regulation of AKT and FGFR activities.
25326807 2015 Cripto-1 expression and its prognostic value in human bladder cancer patients.
More...