Property Summary

NCBI Gene PubMed Count 85
PubMed Score 160.37
PubTator Score 75.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Holoprosencephaly 56 3.771 1.9
Heterotaxy Syndrome 5 0.0 0.0
Disease Target Count Z-score Confidence
Cancer 2499 4.116 2.1

Expression

Gene RIF (63)

AA Sequence

MDCRKMARFSYSVIWIMAISKVFELGLVAGLGHQEFARPSRGYLAFRDDSIWPQEEPAIRPRSSQRVPPM      1 - 70
GIQHSKELNRTCCLNGGTCMLGSFCACPPSFYGRNCEHDVRKENCGSVPHDTWLPKKCSLCKCWHGQLRC     71 - 140
FPQAFLPGCDGLVMDEHLVASRTPELPPSARTTTFMLVGICLSIQSYY                          141 - 188
//

Text Mined References (88)

PMID Year Title