Property Summary

NCBI Gene PubMed Count 22
Grant Count 120
R01 Count 71
Funding $12,760,899
PubMed Score 283.78
PubTator Score 111.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Synonym

Accession P13349 Q6ISR9 Myf-5
Symbols bHLHc2

Gene

Gene RIF (8)

PMID Text
24595098 Pitx2c expression is reactivated, while expression of Myf5 is downregulated in human systolic heart failure as determined by qRT-PCR and Western blot analyses.
21810080 results are the first demonstration of a myogenic conversion of human mesenchymal and endothelial cells by Myf5
19829708 DUX4c induces the MYF5 protein and myoblast proliferation, and has a role in facioscapulohumeral muscular dystrophy
19453261 Observational study of gene-disease association. (HuGE Navigator)
19192046 A novel homozygous polymorphism that prevented the binding of MYF-5 to FOXE1 promoter and affected the FOXE1 expression was found in 45% nonsyndromic cleft palate.
16614355 Myogenin and myogenic differentiation factor D (MyoD) mRNAs increased (P < 0.05) in young and old, whereas myogenic factor (myf)-5 mRNA increased in young only (P < 0.05). Myf-6 protein increased (P < 0.05) in both young and old.
12204280 Mrf4 expression precedes or is contemporaneous with that of Myf5, suggesting that this transcription factor plays a hitherto unsuspected role in myogenesis
12105204 The myogenic basic helix-loop-helix family of transcription factors, MyoD, Myf5, myogenin, and MRF4, can each activate the muscle differentiation program.

AA Sequence

MDVMDGCQFSPSEYFYDGSCIPSPEGEFGDEFVPRVAAFGAHKAELQGSDEDEHVRAPTGHHQAGHCLMW      1 - 70
ACKACKRKSTTMDRRKAATMRERRRLKKVNQAFETLKRCTTTNPNQRLPKVEILRNAIRYIESLQELLRE     71 - 140
QVENYYSLPGQSCSEPTSPTSNCSDGMPECNSPVWSRKSSTFDSIYCPDVSNVYATDKNSLSSLDCLSNI    141 - 210
VDRITSSEQPGLPLQDLASLSPVASTDSQPATPGASSSRLIYHVL                             211 - 255
//

Text Mined References (23)

PMID Year Title
24595098 2014 Pitx2c is reactivated in the failing myocardium and stimulates myf5 expression in cultured cardiomyocytes.
21810080 2011 Efficient in vitro myogenic reprogramming of human primary mesenchymal stem cells and endothelial cells by Myf5.
19829708 2009 DUX4c is up-regulated in FSHD. It induces the MYF5 protein and human myoblast proliferation.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19192046 2009 Altered binding of MYF-5 to FOXE1 promoter in non-syndromic and CHARGE-associated cleft palate.
16614355 2006 Efficacy of 3 days/wk resistance training on myofiber hypertrophy and myogenic mechanisms in young vs. older adults.
15923648 2005 Close encounters: regulation of vertebrate skeletal myogenesis by cell-cell contact.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...