Property Summary

NCBI Gene PubMed Count 19
PubMed Score 146.68
PubTator Score 45.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Dermatitis, Allergic Contact 67 0.0 0.0
Leukemia, Myeloid, Acute 105 0.0 0.0
Disease Target Count
Leukemia, Myelocytic, Acute 120
Disease Target Count Z-score Confidence
Atrophic rhinitis 8 3.016 1.5

Expression

 MGI Phenotype (1)

 CSPA Cell Line (3)

Gene RIF (12)

AA Sequence

MTLSPLLLFLPPLLLLLDVPTAAVQASPLQALDFFGNGPPVNYKTGNLYLRGPLKKSNAPLVNVTLYYEA      1 - 70
LCGGCRAFLIRELFPTWLLVMEILNVTLVPYGNAQEQNVSGRWEFKCQHGEEECKFNKVEACVLDELDME     71 - 140
LAFLTIVCMEEFEDMERSLPLCLQLYAPGLSPDTIMECAMGDRGMQLMHANAQRTDALQPPHEYVPWVTV    141 - 210
NGKPLEDQTQLLTLVCQLYQGKKPDVCPSSTSSLRSVCFK                                  211 - 250
//

Text Mined References (25)

PMID Year Title