Property Summary

NCBI Gene PubMed Count 139
Grant Count 144
R01 Count 76
Funding $12,423,561.36
PubMed Score 903.53
PubTator Score 1228.59

Knowledge Summary

Patent

No data available

Synonym

Accession P13236 P22617 Q13704 Q3SXL8 Q6FGI8
Symbols ACT2
G-26
HC21
LAG1
LAG-1
MIP1B
SCYA2
SCYA4
MIP1B1
AT744.1
MIP-1-beta

Gene

PDB

4RAL   1HUM   1HUN   1JE4   2FFK   2FIN   2X6L   3TN2  

Gene RIF (154)

PMID Text
26874795 High serum IL-12 levels associated with increased densities of peritumoral CD8(+) T cells, intraepithelial CD3(+) T cells and intratumoral neutrophils, while high serum CCL4 levels associated with increased densities of peritumoral CD68(+) cells
26854929 Tregs from subjects with established type 1 diabetes were impaired in their ability to produce CCL3 and CCL4.
26786659 YY1 regulates lung CCL4 transcription in pulmonary tuberculosis.
26786652 Report use of up-converting phosphor reporter technology in a lateral flow based test to determine CCL4 levels in pleural effusions and whole blood for tuberculosis diagnosis.
26285074 clinical samples, confirmed TB and non-TB (i.e. other respiratory diseases (ORD)) cases, were collected and analyzed simultaneously with quality control (QC) human IP-10 or CCL4 standards
26284335 CCL4 and CCL20 recruit functionally different T lymphocyte subsets into oesophageal carcinoma.
26270232 High serum levels of inflammatory chemokines such as CCL4 and CCL5 in the serum of cirrhotic patients indicate the presence of hepatocellular carcinoma.
26158606 IL8, IL-1Ra, MCP-1, and MIP-1beta are significantly lower in patients with type 1 diabetes than controls.
26115437 Elevated pre-treatment levels of CCL4 identified long-term immunological nonresponse patients who started treatment at CD4 counts<200.
26074318 MIP-1beta, TNF-alpha and fractalkine are expressed in plasma, which reflects the levels of several pro-atherogenic cytokines in plaque tissue
More...

AA Sequence

MKLCVTVLSLLMLVAAFCSPALSAPMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRS      1 - 70
KQVCADPSESWVQEYVYDLELN                                                     71 - 92
//

Text Mined References (139)

PMID Year Title
26874795 2016 The relationships between serum cytokine levels and tumor infiltrating immune cells and their clinical significance in colorectal cancer.
26854929 2016 T regulatory cell chemokine production mediates pathogenic T cell attraction and suppression.
26786659 2016 A novel role of Yin-Yang-1 in pulmonary tuberculosis through the regulation of the chemokine CCL4.
26786652 2016 Use of lateral flow assays to determine IP-10 and CCL4 levels in pleural effusions and whole blood for TB diagnosis.
26285074 2016 Multi-center evaluation of a user-friendly lateral flow assay to determine IP-10 and CCL4 levels in blood of TB and non-TB cases in Africa.
26284335 2015 CTL- vs Treg lymphocyte-attracting chemokines, CCL4 and CCL20, are strong reciprocal predictive markers for survival of patients with oesophageal squamous cell carcinoma.
26270232 2015 Serum levels of chemokines CCL4 and CCL5 in cirrhotic patients indicate the presence of hepatocellular carcinoma.
26158606 2015 Large-Scale Discovery and Validation Studies Demonstrate Significant Reductions in Circulating Levels of IL8, IL-1Ra, MCP-1, and MIP-1? in Patients With Type 1 Diabetes.
26115437 2015 High MIP-1? Levels in Plasma Predict Long-Term Immunological Nonresponse to Suppressive Antiretroviral Therapy in HIV Infection.
26074318 2015 Circulating cytokines reflect the expression of pro-inflammatory cytokines in atherosclerotic plaques.
More...