Property Summary

NCBI Gene PubMed Count 146
PubMed Score 952.02
PubTator Score 1228.59

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count
Dermatologic disorders 93

Expression

  Differential Expression (25)

Disease log2 FC p
tuberculosis -2.600 3.2e-06
adult high grade glioma 1.200 4.9e-03
aldosterone-producing adenoma -1.081 1.8e-02
astrocytoma 2.700 4.6e-02
Astrocytoma, Pilocytic 2.800 9.9e-05
cutaneous lupus erythematosus 2.100 9.8e-03
diabetes mellitus 2.100 1.4e-03
ependymoma 1.200 5.4e-04
gastric cancer 1.300 2.3e-03
glioblastoma 1.200 2.6e-05
head and neck cancer and chronic obstruc... 1.300 4.4e-03
hepatocellular carcinoma 1.100 3.5e-04
interstitial cystitis 1.500 1.3e-02
intraductal papillary-mucinous carcinoma... -1.100 3.8e-03
intraductal papillary-mucinous neoplasm ... -1.100 1.6e-02
invasive ductal carcinoma 1.100 3.1e-02
lung adenocarcinoma -1.178 2.4e-04
lung cancer -1.300 9.8e-04
lung carcinoma -1.200 7.3e-05
medulloblastoma 1.300 2.4e-03
nasopharyngeal carcinoma 1.200 2.3e-04
non-small cell lung cancer -1.392 4.4e-08
psoriasis 1.100 1.6e-03
type I diabetes mellitus -1.266 1.1e-02
ulcerative colitis 2.600 1.3e-04

Synonym

Accession P13236 P22617 Q13704 Q3SXL8 Q6FGI8
Symbols ACT2
G-26
HC21
LAG1
LAG-1
MIP1B
SCYA2
SCYA4
MIP1B1
AT744.1
MIP-1-beta

Gene

PDB

4RAL   1HUM   1HUN   1JE4   2FFK   2FIN   2X6L   3TN2  

  Ortholog (1)

Species Source Disease
Rat OMA Inparanoid

Protein-protein Interaction (5)

Gene RIF (155)

AA Sequence

MKLCVTVLSLLMLVAAFCSPALSAPMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRS      1 - 70
KQVCADPSESWVQEYVYDLELN                                                     71 - 92
//

Text Mined References (146)

PMID Year Title