Property Summary

NCBI Gene PubMed Count 201
Grant Count 974
R01 Count 493
Funding $134,427,088.1
PubMed Score 1163.19
PubTator Score 875.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
glioblastoma 1.200 0.008
intraductal papillary-mucinous adenoma (... 1.600 0.004
intraductal papillary-mucinous neoplasm ... 1.800 0.006
colon cancer -1.600 0.008
lung cancer -2.700 0.000
active Crohn's disease 1.759 0.003
sarcoidosis 1.400 0.012
pancreatic cancer 1.200 0.002
adult high grade glioma 1.300 0.000
pilocytic astrocytoma 1.100 0.000
Breast cancer -1.300 0.024
lung carcinoma -1.600 0.000

Synonym

Accession P13232 A0N0L3 Q5FBY5 Q5FBY9 IL-7
Symbols IL-7

Gene

IL7

PDB

3DI2   3DI3   1IL7  

Gene RIF (190)

PMID Text
26615570 Observed highly significant reductions in the concentration of circulating interleukin (IL)-16, IL-7, and Vascular Endothelial Growth Factor A (VEGF-A) in encephalomyelitis/chronic fatigue syndrome patients.
26479922 IL7 was expressed primarily in the infundibulum and suprabulb of the hair follicle. IL7 expression was increased in cutaneous T-cell lymphoma.
26324773 this study identified that IL-7, as well as the Akt/ mTOR signaling pathway, effectively modulates human Double-Negative T Cell- mediated suppression of allogeneic T cell responses.
26272555 provides negative feedback on its own signaling in T cells via endocytosis and degradation of its receptor, CD127
26177551 IL-7 and SCF are elevated for a prolonged period after double umbilical cord blood transplantation and persistently high levels of these cytokines may correlate with worse clinical outcomes.
26113403 The observations suggest that IL-7 may play a role in the pathogenesis of Graves' disease and may be associated with its clinical activity.
26085358 Common gamma-chain cytokines IL-2, IL-7, and IL-15 prevent differentiation of naive T cells in vitro and limit activation of primed T cells in the absence of antigenic stimulus, which can contribute to the formation of cytokine imbalance.
25933188 IL-7/IL-17 axis mediates chronic pelvic pain in experimental autoimmune prostatitis and in patients.
25870237 These observations provide evidence of a novel mechanism that enables cells to optimally use IL-7.
25784743 Interferon-alpha inhibits CD4 T cell responses to interleukin-7 and interleukin-2 and selectively interferes with Akt signaling.
More...

AA Sequence

MFHVSFRYIFGLPPLILVLLPVASSDCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRH      1 - 70
ICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEE     71 - 140
NKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH                                     141 - 177
//

Text Mined References (202)

PMID Year Title
27342246 2016 A combinatorial approach of N-terminus blocking and codon optimization strategies to enhance the soluble expression of recombinant hIL-7 in E. coli fed-batch culture.
26615570 2016 Reductions in circulating levels of IL-16, IL-7 and VEGF-A in myalgic encephalomyelitis/chronic fatigue syndrome.
26479922 2015 Hair follicle-derived IL-7 and IL-15 mediate skin-resident memory T cell homeostasis and lymphoma.
26324773 2015 IL-7 Abrogates the Immunosuppressive Function of Human Double-Negative T Cells by Activating Akt/mTOR Signaling.
26272555 2016 IL-7 induces clathrin-mediated endocytosis of CD127 and subsequent degradation by the proteasome in primary human CD8 T cells.
26177551 2015 IL-7 and SCF Levels Inversely Correlate with T Cell Reconstitution and Clinical Outcomes after Cord Blood Transplantation in Adults.
26113403 2015 Decreased serum level of IL-7 in patients with active Graves' disease.
26085358 2015 Effects of Immunoregulatory Cytokines (IL-2, IL-7, and IL-15) on Expression of Gfi1 and U2afll4 Genes in T Cells at Different Stages of Differentiation.
25933188 2015 IL17 Mediates Pelvic Pain in Experimental Autoimmune Prostatitis (EAP).
25870237 2015 Recycled IL-7 Can Be Delivered to Neighboring T Cells.
More...