Property Summary

NCBI Gene PubMed Count 223
PubMed Score 1222.20
PubTator Score 875.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
active Crohn's disease 1.759 3.5e-03
adult high grade glioma 1.300 1.7e-04
Astrocytoma, Pilocytic 1.100 5.6e-05
Breast cancer -1.300 2.4e-02
colon cancer -1.600 7.9e-03
glioblastoma 1.200 8.4e-03
intraductal papillary-mucinous adenoma (... 1.600 3.6e-03
intraductal papillary-mucinous neoplasm ... 1.800 5.9e-03
lung cancer -2.700 1.4e-05
lung carcinoma -1.600 4.1e-27
pancreatic cancer 1.200 1.8e-03
sarcoidosis 1.400 1.2e-02

Protein-protein Interaction (7)

Gene RIF (208)

AA Sequence

MFHVSFRYIFGLPPLILVLLPVASSDCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRH      1 - 70
ICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEE     71 - 140
NKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH                                     141 - 177
//

Text Mined References (224)

PMID Year Title