Property Summary

NCBI Gene PubMed Count 201
PubMed Score 1163.19
PubTator Score 875.22

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Expression

  Differential Expression (12)

Disease log2 FC p
glioblastoma 1.200 0.008
intraductal papillary-mucinous adenoma (... 1.600 0.004
intraductal papillary-mucinous neoplasm ... 1.800 0.006
colon cancer -1.600 0.008
lung cancer -2.700 0.000
active Crohn's disease 1.759 0.003
sarcoidosis 1.400 0.012
pancreatic cancer 1.200 0.002
adult high grade glioma 1.300 0.000
pilocytic astrocytoma 1.100 0.000
Breast cancer -1.300 0.024
lung carcinoma -1.600 0.000

Synonym

Accession P13232 A0N0L3 Q5FBY5 Q5FBY9 IL-7
Symbols IL-7

Gene

IL7

PDB

3DI2   3DI3   1IL7  

  Ortholog (8)

Gene RIF (185)

PMID Text
26615570 Observed highly significant reductions in the concentration of circulating interleukin (IL)-16, IL-7, and Vascular Endothelial Growth Factor A (VEGF-A) in encephalomyelitis/chronic fatigue syndrome patients.
26479922 IL7 was expressed primarily in the infundibulum and suprabulb of the hair follicle. IL7 expression was increased in cutaneous T-cell lymphoma.
26324773 this study identified that IL-7, as well as the Akt/ mTOR signaling pathway, effectively modulates human Double-Negative T Cell- mediated suppression of allogeneic T cell responses.
26272555 provides negative feedback on its own signaling in T cells via endocytosis and degradation of its receptor, CD127
26177551 IL-7 and SCF are elevated for a prolonged period after double umbilical cord blood transplantation and persistently high levels of these cytokines may correlate with worse clinical outcomes.
26113403 The observations suggest that IL-7 may play a role in the pathogenesis of Graves' disease and may be associated with its clinical activity.
26085358 Common gamma-chain cytokines IL-2, IL-7, and IL-15 prevent differentiation of naive T cells in vitro and limit activation of primed T cells in the absence of antigenic stimulus, which can contribute to the formation of cytokine imbalance.
25933188 IL-7/IL-17 axis mediates chronic pelvic pain in experimental autoimmune prostatitis and in patients.
25870237 These observations provide evidence of a novel mechanism that enables cells to optimally use IL-7.
25784743 Interferon-alpha inhibits CD4 T cell responses to interleukin-7 and interleukin-2 and selectively interferes with Akt signaling.
More...

AA Sequence

MFHVSFRYIFGLPPLILVLLPVASSDCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRH      1 - 70
ICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEE     71 - 140
NKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH                                     141 - 177
//

Text Mined References (202)

PMID Year Title
27342246 2016 A combinatorial approach of N-terminus blocking and codon optimization strategies to enhance the soluble expression of recombinant hIL-7 in E. coli fed-batch culture.
26615570 2016 Reductions in circulating levels of IL-16, IL-7 and VEGF-A in myalgic encephalomyelitis/chronic fatigue syndrome.
26479922 2015 Hair follicle-derived IL-7 and IL-15 mediate skin-resident memory T cell homeostasis and lymphoma.
26324773 2015 IL-7 Abrogates the Immunosuppressive Function of Human Double-Negative T Cells by Activating Akt/mTOR Signaling.
26272555 2016 IL-7 induces clathrin-mediated endocytosis of CD127 and subsequent degradation by the proteasome in primary human CD8 T cells.
26177551 2015 IL-7 and SCF Levels Inversely Correlate with T Cell Reconstitution and Clinical Outcomes after Cord Blood Transplantation in Adults.
26113403 2015 Decreased serum level of IL-7 in patients with active Graves' disease.
26085358 2015 Effects of Immunoregulatory Cytokines (IL-2, IL-7, and IL-15) on Expression of Gfi1 and U2afll4 Genes in T Cells at Different Stages of Differentiation.
25933188 2015 IL17 Mediates Pelvic Pain in Experimental Autoimmune Prostatitis (EAP).
25870237 2015 Recycled IL-7 Can Be Delivered to Neighboring T Cells.
More...