Property Summary

NCBI Gene PubMed Count 55
PubMed Score 130.03
PubTator Score 108.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (28)

Disease log2 FC p
active Crohn's disease 1.532 1.9e-02
active ulcerative colitis 1.281 1.3e-02
acute quadriplegic myopathy 1.129 7.1e-04
autosomal dominant Emery-Dreifuss muscul... 1.088 9.9e-03
Breast cancer 1.600 5.5e-06
colon cancer 1.100 1.0e-03
cutaneous lupus erythematosus 2.000 1.3e-04
cystic fibrosis 1.988 4.0e-03
dermatomyositis 1.700 8.8e-03
Down syndrome 1.500 1.9e-02
Duchenne muscular dystrophy 1.259 7.2e-06
esophageal adenocarcinoma 1.400 4.3e-02
group 3 medulloblastoma -1.200 1.9e-02
intraductal papillary-mucinous adenoma (... -2.200 1.2e-05
juvenile dermatomyositis 3.064 1.6e-20
limb girdle muscular dystrophy 2A 1.106 1.1e-04
lung cancer -1.100 8.1e-03
malignant mesothelioma 3.700 4.9e-08
medulloblastoma, large-cell -1.600 1.6e-03
Multiple myeloma 2.591 8.5e-03
ovarian cancer -1.300 1.7e-03
pancreatic cancer 1.100 1.7e-02
pituitary cancer -2.700 3.9e-07
posterior fossa group A ependymoma 1.600 7.9e-05
primary pancreatic ductal adenocarcinoma 1.073 2.4e-02
primary Sjogren syndrome 1.600 2.1e-03
Systemic lupus erythematosus 1.900 1.3e-04
tuberculosis 1.200 2.3e-06

Protein-protein Interaction (1)

Gene RIF (57)

AA Sequence

MHKEEHEVAVLGPPPSTILPRSTVINIHSETSVPDHVVWSLFNTLFLNWCCLGFIAFAYSVKSRDRKMVG      1 - 70
DVTGAQAYASTAKCLNIWALILGILMTIGFILLLVFGSVTVYHIMLQIIQEKRGY                    71 - 125
//

Text Mined References (62)

PMID Year Title