Property Summary

NCBI Gene PubMed Count 48
PubMed Score 118.28
PubTator Score 108.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
juvenile dermatomyositis 1189 1.55022833856615E-20
malignant mesothelioma 3163 4.85993459773337E-8
pituitary cancer 1972 3.85857097396717E-7
ulcerative colitis 2087 8.35190608940903E-7
tuberculosis 1563 2.28985601383629E-6
ovarian cancer 8492 2.4493086870504E-6
Breast cancer 3099 5.51865313502396E-6
Duchenne muscular dystrophy 602 7.21941236942591E-6
intraductal papillary-mucinous adenoma (IPMA) 2956 1.23100643662858E-5
lung cancer 4473 1.34981549961227E-5
posterior fossa group A ependymoma 1511 7.94991479719952E-5
limb girdle muscular dystrophy 2A 156 1.12277092618213E-4
cutaneous lupus erythematosus 1056 1.26948252915456E-4
systemic lupus erythematosus 172 1.29900255993502E-4
acute quadriplegic myopathy 1157 7.12527853045299E-4
colon cancer 1475 0.00104262807486647
medulloblastoma, large-cell 6234 0.0015991642783
primary Sjogren syndrome 789 0.00212495247738407
cystic fibrosis 1670 0.00396967529728768
group 4 medulloblastoma 1875 0.00491169876174274
Multiple myeloma 1328 0.00849574632028081
dermatomyositis 967 0.00883932182611116
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00994754988994008
pancreatic cancer 2300 0.0165978823100174
Down syndrome 548 0.0193097505035272
active Crohn's disease 918 0.0193707375123023
primary pancreatic ductal adenocarcinoma 1271 0.023874296473878
esophageal adenocarcinoma 737 0.0434585366882531
Disease Target Count Z-score Confidence
Endometrial stromal nodule 8 3.527 1.8
Cancer 2346 3.293 1.6

Expression

Synonym

Accession P13164 Q15322 Q53XZ0
Symbols 9-27
CD225
IFI17
LEU13
DSPA2a

Gene

  Ortholog (2)

Species Source
Chimp OMA EggNOG Inparanoid
Cow OMA Inparanoid

Gene RIF (49)

PMID Text
26897526 These findings indicate that overexpression of IFITM1 enhances the aggressive phenotype of triple-negative SUM149 IBC cells and that this effect is dependent on STAT2/BRG1 interaction.
26387945 HIV-1 gp41 interacts with IFITM1
26387945 HIV-1 cell-to-cell transmission (Jurkat-to-Jurkat and PBMCs-to-Jurkat) is inhibited by IFITM1
26354436 propose that the IFITM proteins act in a coordinated manner to restrict HCV infection by targeting the endocytosed HCV virion for lysosomal degradation and demonstrate that the actions of the IFITM proteins are indeed virus and cell-type specific
26259513 Suggest that IFITM1 promotes the aggressiveness of colorectal cancer cells via caveolin-1 signaling.
26116899 HIV-1 gp41 interacts with IFITM1
25738301 the importance of the C-terminal region of IFITM1 in modulating the antiviral function through controlling protein subcellular localization.
25738301 HIV-1 gp41 interacts with IFITM1
25552713 Host IFITM3,IFITM2 and IFITM1 facilitate morphogenesis of the human cytomegalovirus assembly.
25464829 Incorporation of IFITM1, IFITM2 and IFITM3 into HIV-1 virions impair viral fusion and spread.
More...

AA Sequence

MHKEEHEVAVLGPPPSTILPRSTVINIHSETSVPDHVVWSLFNTLFLNWCCLGFIAFAYSVKSRDRKMVG      1 - 70
DVTGAQAYASTAKCLNIWALILGILMTIGFILLLVFGSVTVYHIMLQIIQEKRGY                    71 - 125
//

Text Mined References (55)

PMID Year Title
26897526 2016 Interferon-induced transmembrane protein 1 (IFITM1) overexpression enhances the aggressive phenotype of SUM149 inflammatory breast cancer cells in a signal transducer and activator of transcription 2 (STAT2)-dependent manner.
26354436 2015 The Interferon-induced Transmembrane Proteins, IFITM1, IFITM2, and IFITM3 Inhibit Hepatitis C Virus Entry.
26259513 2015 IFITM1 promotes the metastasis of human colorectal cancer via CAV-1.
25738301 2015 The C-terminal sequence of IFITM1 regulates its anti-HIV-1 activity.
25552713 2015 Human cytomegalovirus exploits interferon-induced transmembrane proteins to facilitate morphogenesis of the virion assembly compartment.
25464829 2014 IFITM proteins incorporated into HIV-1 virions impair viral fusion and spread.
25422070 2014 IFITM proteins are incorporated onto HIV-1 virion particles and negatively imprint their infectivity.
25105503 2014 A membrane topology model for human interferon inducible transmembrane protein 1.
24676393 2014 Aberrant DNA methylation in the IFITM1 promoter enhances the metastatic phenotype in an intraperitoneal xenograft model of human ovarian cancer.
24603679 2014 Interferon-induced transmembrane protein 1 regulates endothelial lumen formation during angiogenesis.
More...