Property Summary

NCBI Gene PubMed Count 48
Grant Count 27
R01 Count 17
Funding $1,361,387.69
PubMed Score 118.28
PubTator Score 108.06

Knowledge Summary

Patent

No data available

Expression

Gene RIF (67)

PMID Text
26897526 These findings indicate that overexpression of IFITM1 enhances the aggressive phenotype of triple-negative SUM149 IBC cells and that this effect is dependent on STAT2/BRG1 interaction.
26387945 HIV-1 gp41 interacts with IFITM1
26387945 HIV-1 gp41 interacts with IFITM1
26387945 HIV-1 gp41 interacts with IFITM1
26387945 HIV-1 cell-to-cell transmission (Jurkat-to-Jurkat and PBMCs-to-Jurkat) is inhibited by IFITM1
26387945 HIV-1 cell-to-cell transmission (Jurkat-to-Jurkat and PBMCs-to-Jurkat) is inhibited by IFITM1
26354436 propose that the IFITM proteins act in a coordinated manner to restrict HCV infection by targeting the endocytosed HCV virion for lysosomal degradation and demonstrate that the actions of the IFITM proteins are indeed virus and cell-type specific
26259513 Suggest that IFITM1 promotes the aggressiveness of colorectal cancer cells via caveolin-1 signaling.
26116899 HIV-1 gp41 interacts with IFITM1
25738301 the importance of the C-terminal region of IFITM1 in modulating the antiviral function through controlling protein subcellular localization.
More...

AA Sequence

MHKEEHEVAVLGPPPSTILPRSTVINIHSETSVPDHVVWSLFNTLFLNWCCLGFIAFAYSVKSRDRKMVG      1 - 70
DVTGAQAYASTAKCLNIWALILGILMTIGFILLLVFGSVTVYHIMLQIIQEKRGY                    71 - 125
//

Text Mined References (55)

PMID Year Title
26897526 2016 Interferon-induced transmembrane protein 1 (IFITM1) overexpression enhances the aggressive phenotype of SUM149 inflammatory breast cancer cells in a signal transducer and activator of transcription 2 (STAT2)-dependent manner.
26354436 2015 The Interferon-induced Transmembrane Proteins, IFITM1, IFITM2, and IFITM3 Inhibit Hepatitis C Virus Entry.
26259513 2015 IFITM1 promotes the metastasis of human colorectal cancer via CAV-1.
25738301 2015 The C-terminal sequence of IFITM1 regulates its anti-HIV-1 activity.
25552713 2015 Human cytomegalovirus exploits interferon-induced transmembrane proteins to facilitate morphogenesis of the virion assembly compartment.
25464829 2014 IFITM proteins incorporated into HIV-1 virions impair viral fusion and spread.
25422070 2014 IFITM proteins are incorporated onto HIV-1 virion particles and negatively imprint their infectivity.
25105503 2014 A membrane topology model for human interferon inducible transmembrane protein 1.
24676393 2014 Aberrant DNA methylation in the IFITM1 promoter enhances the metastatic phenotype in an intraperitoneal xenograft model of human ovarian cancer.
24603679 2014 Interferon-induced transmembrane protein 1 regulates endothelial lumen formation during angiogenesis.
More...