Property Summary

NCBI Gene PubMed Count 40
Grant Count 42
R01 Count 22
Funding $6,175,281.81
PubMed Score 190.95
PubTator Score 76.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
psoriasis 1.800 0.000
osteosarcoma 1.148 0.000
atypical teratoid / rhabdoid tumor -1.500 0.000
glioblastoma -1.200 0.001
medulloblastoma, large-cell -1.500 0.000
tuberculosis and treatment for 6 months 1.200 0.000
ovarian cancer -1.100 0.000

 GWAS Trait (1)

Gene RIF (17)

PMID Text
25726526 We provide evidence that COX4-1 controls BMI1 expression via a redox mechanism
23285255 COXIV mRNA (1.6 fold; P<0.01) and COXIV protein expression (1.5 fold; P<0.05) were increased by training but COXIV protein expression was decreased (20%; P<0.01) by acute exercise pre- and post-training.
22419111 Tat-induced mitochondrial membrane permeabilization is associated with inhibition of cytochrome c oxidase (COX) activity by Tat in disrupted mitochondria from human samples
22190034 Tat-induced mitochondrial membrane permeabilization is associated with inhibition of cytochrome c oxidase (COX) activity by Tat in disrupted mitochondria from human samples
22190034 Tat-induced mitochondrial membrane permeabilization is associated with inhibition of cytochrome c oxidase (COX) activity by Tat in disrupted mitochondria from human samples
22079200 Studies indicate that the cytochrome oxidase enzyme-substrate (ES) Michaelis complex of cell respiration, the dioxygen adduct of heme a(3), which he termed Compound A.
21978537 Studies indicate that the mechanism for proton pumping in cytochrome c oxidase is based on an electrostatic analysis of a kinetic experiment for the O to E transition.
21939634 Studies indicate that nitric oxide (NO) inhibition of cytochrome c oxidase (CcOX) is rapid and reversible and may occur in competition with oxygen.
21841246 COX activity (electron transport complex IV) is reduced by 29% in maternal history of Alzheimer's disease compared to normal controls, and by 30% compared to paternal history of Alzheimer's disease.
21802404 Studies suggest that the main function of nuclear encoded subunits of cytochrome c oxidase appears to be "only" to control the activity of the mitochondrial subunits.
More...

AA Sequence

MLATRVFSLVGKRAISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASW      1 - 70
SSLSMDEKVELYRIKFKESFAEMNRGSNEWKTVVGGAMFFIGFTALVIMWQKHYVYGPLPQSFDKEWVAK     71 - 140
QTKRMLDMKVNPIQGLASKWDYEKNEWKK                                             141 - 169
//

Text Mined References (45)

PMID Year Title
26321642 2015 MITRAC7 Acts as a COX1-Specific Chaperone and Reveals a Checkpoint during Cytochrome c Oxidase Assembly.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25726526 2015 Nuclear-encoded cytochrome c oxidase subunit 4 regulates BMI1 expression and determines proliferative capacity of high-grade gliomas.
25642632 2015 Discovery of six new susceptibility loci and analysis of pleiotropic effects in leprosy.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23400010 2014 Genome-wide association analyses suggest NELL1 influences adverse metabolic response to HCTZ in African Americans.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23285255 2012 Short-term intensified cycle training alters acute and chronic responses of PGC1? and Cytochrome C oxidase IV to exercise in human skeletal muscle.
23260140 2012 MITRAC links mitochondrial protein translocation to respiratory-chain assembly and translational regulation.
More...