Property Summary

NCBI Gene PubMed Count 17
PubMed Score 24.36
PubTator Score 86.98

Knowledge Summary

Patent (15,193)

Expression

  Differential Expression (10)

Disease log2 FC p
Amyotrophic lateral sclerosis 1.086 4.9e-05
group 3 medulloblastoma 1.500 1.4e-02
intraductal papillary-mucinous carcinoma... 1.300 1.5e-02
intraductal papillary-mucinous neoplasm ... 1.500 5.2e-03
lung cancer 2.800 1.2e-04
malignant mesothelioma 1.400 4.7e-06
osteosarcoma -1.701 1.0e-05
ovarian cancer -1.800 9.6e-07
Pick disease -1.500 1.1e-04
progressive supranuclear palsy -1.500 1.5e-02

Gene RIF (7)

AA Sequence

MATIEEIAHQIIEQQMGEIVTEQQTGQKIQIVTALDHNTQGKQFILTNHDGSTPSKVILARQDSTPGKVF      1 - 70
LTTPDAAGVNQLFFTTPDLSAQHLQLLTDNSPDQGPNKVFDLCVVCGDKASGRHYGAVTCEGCKGFFKRS     71 - 140
IRKNLVYSCRGSKDCIINKHHRNRCQYCRLQRCIAFGMKQDSVQCERKPIEVSREKSSNCAASTEKIYIR    141 - 210
KDLRSPLTATPTFVTDSESTRSTGLLDSGMFMNIHPSGVKTESAVLMTSDKAESCQGDLSTLANVVTSLA    211 - 280
NLGKTKDLSQNSNEMSMIESLSNDDTSLCEFQEMQTNGDVSRAFDTLAKALNPGESTACQSSVAGMEGSV    281 - 350
HLITGDSSINYTEKEGPLLSDSHVAFRLTMPSPMPEYLNVHYIGESASRLLFLSMHWALSIPSFQALGQE    351 - 420
NSISLVKAYWNELFTLGLAQCWQVMNVATILATFVNCLHNSLQQDKMSTERRKLLMEHIFKLQEFCNSMV    421 - 490
KLCIDGYEYAYLKAIVLFSPDHPSLENMEQIEKFQEKAYVEFQDYITKTYPDDTYRLSRLLLRLPALRLM    491 - 560
NATITEELFFKGLIGNIRIDSVIPHILKMEPADYNSQIIGHSI                               561 - 603
//

Text Mined References (24)

PMID Year Title