Property Summary

NCBI Gene PubMed Count 17
PubMed Score 21.64
PubTator Score 86.98

Knowledge Summary

Patent (15,193)

Expression

  Differential Expression (10)

Synonym

Accession P13056 A8K5K4 Q15625 Q15626
Symbols TR2

Gene

  TechDev Info (2)

Steve Finkbeiner Neuron specific phenotypes being screened
Jun Qin Signaling network evaluation of transcript factor crosstalk via catTRE/MS

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
504934 other 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify inverse agonists of the liver receptor homolog-1 (LRH-1; NR5A2): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors

Gene RIF (7)

PMID Text
26469385 HIV-1 MA upregulates NR2C1 gene expression in HepG2 cells
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
17010934 The NF1-A transcription factor plays an important role in the transcriptional activation of the TR2 gene expression via a promoter activating cis-element.
12949936 TR2 may function as a negative modulator to suppress androgen receptor function in prostate cancer. Further studies on how to control TR2 function may result in the ability to modulate AR function in prostate cancer.
12615366 TR2 and TR4 can have distinct functions. Existence of differential and bi-directional regulation between PPAR alpha and TR2/TR4. Possible roles in PPAR alpha signaling pathway in human keratinocytes.
12093804 TR2 that may exert an important repressor in regulating ER activity in mammary glands.
12093744 DRED is a 540 kDa complex containing the nuclear orphan receptors TR2 and TR4, which form a heterodimer that binds to the epsilon and gamma globin promoter DR1 sites. TR2 & 4 mRNAs are expressed at all stages of murine and human erythropoiesis.

AA Sequence

MATIEEIAHQIIEQQMGEIVTEQQTGQKIQIVTALDHNTQGKQFILTNHDGSTPSKVILARQDSTPGKVF      1 - 70
LTTPDAAGVNQLFFTTPDLSAQHLQLLTDNSPDQGPNKVFDLCVVCGDKASGRHYGAVTCEGCKGFFKRS     71 - 140
IRKNLVYSCRGSKDCIINKHHRNRCQYCRLQRCIAFGMKQDSVQCERKPIEVSREKSSNCAASTEKIYIR    141 - 210
KDLRSPLTATPTFVTDSESTRSTGLLDSGMFMNIHPSGVKTESAVLMTSDKAESCQGDLSTLANVVTSLA    211 - 280
NLGKTKDLSQNSNEMSMIESLSNDDTSLCEFQEMQTNGDVSRAFDTLAKALNPGESTACQSSVAGMEGSV    281 - 350
HLITGDSSINYTEKEGPLLSDSHVAFRLTMPSPMPEYLNVHYIGESASRLLFLSMHWALSIPSFQALGQE    351 - 420
NSISLVKAYWNELFTLGLAQCWQVMNVATILATFVNCLHNSLQQDKMSTERRKLLMEHIFKLQEFCNSMV    421 - 490
KLCIDGYEYAYLKAIVLFSPDHPSLENMEQIEKFQEKAYVEFQDYITKTYPDDTYRLSRLLLRLPALRLM    491 - 560
NATITEELFFKGLIGNIRIDSVIPHILKMEPADYNSQIIGHSI                               561 - 603
//

Text Mined References (23)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17010934 2006 Transcriptional regulation of the human TR2 orphan receptor gene by nuclear factor 1-A.
16541075 2006 The finished DNA sequence of human chromosome 12.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14521922 2003 Identification of histone deacetylase-3 domains that interact with the orphan nuclear receptor TR2.
More...