Property Summary

NCBI Gene PubMed Count 249
Grant Count 180
R01 Count 137
Funding $15,975,988.23
PubMed Score 456.71
PubTator Score 369.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Synonym

Accession P13010 A8K3X5 Q0Z7V0 Q4VBQ5 Q53HH7 Q7M4N0 Q9UCQ0 Q9UCQ1
Symbols KU80
KUB2
Ku86
NFIV
KARP1
KARP-1

Gene

PDB

1JEQ   1JEY   1Q2Z   1RW2   3RZ9  

Gene RIF (175)

PMID Text
26658510 Depletion of Ku80 in the lens through acute change or a consequence of aging is likely to increase levels of DNA strand breaks, which could negatively influence physiological function and promote lens opacity
26502055 Data show that ubiquitin E3 ligase RNF138 regulates Ku80 antigen ubiquitylation in response to DNA damage.
26464705 DNA methylation modification plays an important role to regulate the gene expression of XRCC5 and XRCC7, from the results that the gene methylation level of the glioma group is higher than that of the normal group
26360636 HIV-1 MA interacts with XRCC5 (Ku80)
26359349 Data suggest that heat shock factor 1 (HSF1) interacts with both Ku autoantigens Ku70 and Ku86 to induce defective non-homologous end joining (NHEJ) repair activity and genomic instability.
25818292 retinoblastoma tumor suppressor protein variants disabled for the interaction with XRCC5 and XRCC6, including a cancer-associated variant, are unable to support canonical non-homologous end-joining despite being able to confer cell-cycle control
25758053 Our data indicated that Ku80 expression level associates with key clinicopathological features and is an independent predictor of the OS and the DFS in pT2N0M0 ESCC patients.
25756210 Polymorphism in XRCC5 gene is associated with Systemic Lupus Erythematosus.
25702660 both the CG carriers/G allele carriers of rs2267437 (XRCC6) and the haplotype AT/CC established by the SNPs of XRCC5 are associated with ESCC (Esophageal Squamous Cell Carcinoma) susceptibility.
25527410 Polymorphisms in the Variable Number of Tandem Repeats at the promoter region of the XRCC5 is associated with gastric cancer.
More...

AA Sequence

MVRSGNKAAVVLCMDVGFTMSNSIPGIESPFEQAKKVITMFVQRQVFAENKDEIALVLFGTDGTDNPLSG      1 - 70
GDQYQNITVHRHLMLPDFDLLEDIESKIQPGSQQADFLDALIVSMDVIQHETIGKKFEKRHIEIFTDLSS     71 - 140
RFSKSQLDIIIHSLKKCDISLQFFLPFSLGKEDGSGDRGDGPFRLGGHGPSFPLKGITEQQKEGLEIVKM    141 - 210
VMISLEGEDGLDEIYSFSESLRKLCVFKKIERHSIHWPCRLTIGSNLSIRIAAYKSILQERVKKTWTVVD    211 - 280
AKTLKKEDIQKETVYCLNDDDETEVLKEDIIQGFRYGSDIVPFSKVDEEQMKYKSEGKCFSVLGFCKSSQ    281 - 350
VQRRFFMGNQVLKVFAARDDEAAAVALSSLIHALDDLDMVAIVRYAYDKRANPQVGVAFPHIKHNYECLV    351 - 420
YVQLPFMEDLRQYMFSSLKNSKKYAPTEAQLNAVDALIDSMSLAKKDEKTDTLEDLFPTTKIPNPRFQRL    421 - 490
FQCLLHRALHPREPLPPIQQHIWNMLNPPAEVTTKSQIPLSKIKTLFPLIEAKKKDQVTAQEIFQDNHED    491 - 560
GPTAKKLKTEQGGAHFSVSSLAEGSVTSVGSVNPAENFRVLVKQKKASFEEASNQLINHIEQFLDTNETP    561 - 630
YFMKSIDCIRAFREEAIKFSEEQRFNNFLKALQEKVEIKQLNHFWEIVVQDGITLITKEEASGSSVTAEE    631 - 700
AKKFLAPKDKPSGDTAAVFEEGGDVDDLLDMI                                          701 - 732
//

Text Mined References (261)

PMID Year Title
26658510 2015 Ku80 Counters Oxidative Stress-Induced DNA Damage and Cataract Formation in the Human Lens.
26502055 2015 The RNF138 E3 ligase displaces Ku to promote DNA end resection and regulate DNA repair pathway choice.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26464705 2015 Blood-based DNA methylation of DNA repair genes in the non-homologous end-joining (NEHJ) pathway in patient with glioma.
26359349 2015 Heat shock factor 1, an inhibitor of non-homologous end joining repair.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25941166 2015 XLS (c9orf142) is a new component of mammalian DNA double-stranded break repair.
25852083 2015 DNA-dependent protein kinase (DNA-PK) permits vascular smooth muscle cell proliferation through phosphorylation of the orphan nuclear receptor NOR1.
25818292 2015 Direct involvement of retinoblastoma family proteins in DNA repair by non-homologous end-joining.
25758053 2015 Prognostic significance of Ku80 in pT2N0M0 esophageal squamous cell carcinoma after Ivor-Lewis esophagectomy.
More...