Property Summary

NCBI Gene PubMed Count 22
Grant Count 10
Funding $2,257,254.45
PubMed Score 34.24
PubTator Score 27.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis 1.100 0.001
osteosarcoma -1.661 0.001
non primary Sjogren syndrome sicca 1.100 0.026

Gene RIF (9)

PMID Text
23812588 In t(8;21) leukemia cells, LYL1 functions as a component of the stable AML1-ETO-containing transcription factor complex (AETFC). The AETFC components cooperatively regulate gene expression and contribute to leukemogenesis.
23327922 Transcriptional regulators cooperate to establish or maintain primitive stem cell-like signatures in leukemic cells.
20844761 LYL1 degradation is directed by a N-terminal PEST rich site in a phosphorylation-independent manner.
20418284 LYL1 activity is required for the maturation of newly formed blood vessels in adulthood.
19671288 The abnormal expression and protein interaction of LMO2 and LYL1 may play a role in the abnormal proliferation and differentiation of myeloid hematopoietic cells.
19608273 Multiple mechanisms which activate LYL1 in leukemic cells, including structural genomic alterations, namely microdeletion or amplification, together with the involvement of prominent oncogenic transcription factors.
19176012 Over-expression of LYL1 is highly associated with AML as well as ALL.
18160048 Lyl1 interacts with CREB1 and alters expression of CREB1 target genes.
16094422 LYL1 may play a role in early hematopoiesis and may be a potential oncogenic factor in AML

AA Sequence

MCPPQAQAEVGPTMTEKAEMVCAPSPAPAPPPKPASPGPPQVEEVGHRGGSSPPRLPPGVPVISLGHSRP      1 - 70
PGVAMPTTELGTLRPPLLQLSTLGTAPPTLALHYHPHPFLNSVYIGPAGPFSIFPSSRLKRRPSHCELDL     71 - 140
AEGHQPQKVARRVFTNSRERWRQQNVNGAFAELRKLLPTHPPDRKLSKNEVLRLAMKYIGFLVRLLRDQA    141 - 210
AALAAGPTPPGPRKRPVHRVPDDGARRGSGRRAEAAARSQPAPPADPDGSPGGAARPIKMEQTALSPEVR    211 - 280
//

Text Mined References (23)

PMID Year Title
23812588 2013 A stable transcription factor complex nucleated by oligomeric AML1-ETO controls leukaemogenesis.
23327922 2013 Activity of a heptad of transcription factors is associated with stem cell programs and clinical outcome in acute myeloid leukemia.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20844761 2010 LYL1 degradation by the proteasome is directed by a N-terminal PEST rich site in a phosphorylation-independent manner.
20418284 2010 LYL1 activity is required for the maturation of newly formed blood vessels in adulthood.
19671288 2009 [Abnormal expression of transcription factors LYL1 and LMO2 and interaction between them in myeloid leukemia].
19608273 2010 Multiple mechanisms induce ectopic expression of LYL1 in subsets of T-ALL cell lines.
19176012 2008 [Expression of transcription factor LYL1 in leukemia and its possible role in leukemogenesis].
18160048 2008 Lyl1 interacts with CREB1 and alters expression of CREB1 target genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...