Property Summary

NCBI Gene PubMed Count 22
PubMed Score 35.27
PubTator Score 27.85

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (3)

Disease log2 FC p
non primary Sjogren syndrome sicca 1.100 2.6e-02
osteosarcoma -1.661 1.0e-03
psoriasis 1.100 8.1e-04

Gene RIF (9)

AA Sequence

MCPPQAQAEVGPTMTEKAEMVCAPSPAPAPPPKPASPGPPQVEEVGHRGGSSPPRLPPGVPVISLGHSRP      1 - 70
PGVAMPTTELGTLRPPLLQLSTLGTAPPTLALHYHPHPFLNSVYIGPAGPFSIFPSSRLKRRPSHCELDL     71 - 140
AEGHQPQKVARRVFTNSRERWRQQNVNGAFAELRKLLPTHPPDRKLSKNEVLRLAMKYIGFLVRLLRDQA    141 - 210
AALAAGPTPPGPRKRPVHRVPDDGARRGSGRRAEAAARSQPAPPADPDGSPGGAARPIKMEQTALSPEVR    211 - 280
//

Text Mined References (23)

PMID Year Title