Property Summary

NCBI Gene PubMed Count 261
Grant Count 276
R01 Count 195
Funding $24,829,354.65
PubMed Score 665.64
PubTator Score 302.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.248 0.002
ovarian cancer 1.700 0.000

Synonym

Accession P12956 B1AHC8 Q6FG89 Q9UCQ2 Q9UCQ3
Symbols ML8
KU70
TLAA
CTC75
CTCBF
G22P1

Gene

PDB

1JEQ   1JEY   1JJR   3RZX  

Gene RIF (182)

PMID Text
26976509 Ku is intact and retains DNA binding activity in early apoptotic cells.
26772202 Results show that under hypoxia, Ku70 and DNA-PKcs interact with nuclear RON which activates non-homologous end joining DNA repair conferring chemoresistance.
26754263 We believe that for the first time, genetic variants at XRCC6 and MVP genes are associated with risk of more aggressive disease, and would be taken into account when assessing the malignancy of prostate cancer
26712563 Our results demonstrate that the phosphorylation-mediated dissociation of Ku70/80 from DSBs frees DNA ends, allowing the initiation of HR in S phase and providing a mechanism of DSB repair pathway choice in mammalian cells.
26360636 HIV-1 MA interacts with XRCC6 (Ku70)
26359349 Data suggest that heat shock factor 1 (HSF1) interacts with both Ku autoantigens Ku70 and Ku86 to induce defective non-homologous end joining (NHEJ) repair activity and genomic instability.
26337656 these data unveil an involvement of phospho-Ku70 in fast but inaccurate DNA repair; a new paradigm linked to both the deregulation of canonical nonhomologous end-joining and the resistance of malignant cells
26149939 XRCC6 may play an important role in the carcinogenesis of NPC and could serve as a chemotherapeutic target for personalized medicine and therapy.
26055322 A direct interaction between Ku70/86 and BRG1 brings together SWI/SNF remodeling capabilities and TOP2beta activity to enhance the transcriptional response to hormone stimulation.
25818292 retinoblastoma tumor suppressor protein variants disabled for the interaction with XRCC5 and XRCC6, including a cancer-associated variant, are unable to support canonical non-homologous end-joining despite being able to confer cell-cycle control
More...

AA Sequence

MSGWESYYKTEGDEEAEEEQEENLEASGDYKYSGRDSLIFLVDASKAMFESQSEDELTPFDMSIQCIQSV      1 - 70
YISKIISSDRDLLAVVFYGTEKDKNSVNFKNIYVLQELDNPGAKRILELDQFKGQQGQKRFQDMMGHGSD     71 - 140
YSLSEVLWVCANLFSDVQFKMSHKRIMLFTNEDNPHGNDSAKASRARTKAGDLRDTGIFLDLMHLKKPGG    141 - 210
FDISLFYRDIISIAEDEDLRVHFEESSKLEDLLRKVRAKETRKRALSRLKLKLNKDIVISVGIYNLVQKA    211 - 280
LKPPPIKLYRETNEPVKTKTRTFNTSTGGLLLPSDTKRSQIYGSRQIILEKEETEELKRFDDPGLMLMGF    281 - 350
KPLVLLKKHHYLRPSLFVYPEESLVIGSSTLFSALLIKCLEKEVAALCRYTPRRNIPPYFVALVPQEEEL    351 - 420
DDQKIQVTPPGFQLVFLPFADDKRKMPFTEKIMATPEQVGKMKAIVEKLRFTYRSDSFENPVLQQHFRNL    421 - 490
EALALDLMEPEQAVDLTLPKVEAMNKRLGSLVDEFKELVYPPDYNPEGKVTKRKHDNEGSGSKRPKVEYS    491 - 560
EEELKTHISKGTLGKFTVPMLKEACRAYGLKSGLKKQELLEALTKHFQD                         561 - 609
//

Text Mined References (275)

PMID Year Title
26976509 2016 DNA binding activity of Ku during chemotherapeutic agent-induced early apoptosis.
26772202 2016 RON Nuclear Translocation under Hypoxia Potentiates Chemoresistance to DNA Double-Strand Break-Inducing Anticancer Drugs.
26754263 2016 Association between single-nucleotide polymorphisms in DNA double-strand break repair genes and prostate cancer aggressiveness in the Spanish population.
26712563 2016 Phosphorylation of Ku dictates DNA double-strand break (DSB) repair pathway choice in S phase.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26359349 2015 Heat shock factor 1, an inhibitor of non-homologous end joining repair.
26337656 2015 A new phosphorylated form of Ku70 identified in resistant leukemic cells confers fast but unfaithful DNA repair in cancer cell lines.
26149939 2015 The role of XRCC6/Ku70 in nasopharyngeal carcinoma.
26055322 2015 Glucocorticoid Receptor Transcriptional Activation via the BRG1-Dependent Recruitment of TOP2? and Ku70/86.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
More...