Property Summary

Ligand Count 655
NCBI Gene PubMed Count 1,034
PubMed Score 9201.69
PubTator Score 3297.81

Knowledge Summary

Patent (365,075)

TINX Plot

  Disease (8)

Disease Target Count P-value
ovarian cancer 8520 1.6e-07
osteosarcoma 7950 2.4e-07
tuberculosis 2010 3.6e-05
group 4 medulloblastoma 1855 1.1e-04
psoriasis 6694 1.1e-04
COPD 118 2.7e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Kidney cancer 2613 0.0 0.7
Disease Target Count Z-score Confidence
Cancer 2499 6.867 3.4

Expression

  Differential Expression (6)

Disease log2 FC p
COPD -1.200 2.7e-03
group 4 medulloblastoma 1.100 1.1e-04
osteosarcoma 3.039 2.4e-07
ovarian cancer -1.100 1.6e-07
psoriasis 1.900 1.1e-04
tuberculosis -1.500 3.6e-05

Synonym

Accession P12931 E1P5V4 Q76P87 Q86VB9 Q9H5A8
Symbols ASV
SRC1
THC6
c-SRC
p60-Src

Gene

SRC

PDB

3VRO   1A07   1A08   1A09   1A1A   1A1B   1A1C   1A1E   1FMK   1HCS   1HCT   1KSW   1O41   1O42   1O43   1O44   1O45   1O46   1O47   1O48   1O49   1O4A   1O4B   1O4C   1O4D   1O4E   1O4F   1O4G   1O4H   1O4I   1O4J   1O4K   1O4L   1O4M   1O4N   1O4O   1O4P   1O4Q   1O4R   1SHD   1Y57   1YI6   1YOJ   1YOL   1YOM   2BDF   2BDJ   2H8H   2SRC   3ZMP   3ZMQ   4F59   4F5A   4F5B   4HXJ   4K11   4MXO   4MXX   4MXY   4MXZ  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (4)

Gene RIF (635)

AA Sequence

MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPASADGHRGPSAAFAPAAAEPKLFGGFNSS      1 - 70
DTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLSTGQTGYIPSNYV     71 - 140
APSDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKL    141 - 210
DSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGC    211 - 280
FGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLL    281 - 350
DFLKGETGKYLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYT    351 - 420
ARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPPEC    421 - 490
PESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGENL                            491 - 536
//

Text Mined References (1073)

PMID Year Title