Property Summary

NCBI Gene PubMed Count 30
PubMed Score 1122.94
PubTator Score 509.68

Knowledge Summary

Patent

No data available

Expression

Gene RIF (11)

AA Sequence

MVSRKAVAALLVVHVAAMLASQTEAFVPIFTYGELQRMQEKERNKGQKKSLSVWQRSGEEGPVDPAEPIR      1 - 70
EEENEMIKLTAPLEIGMRMNSRQLEKYPATLEGLLSEMLPQHAAK                              71 - 115
//

Text Mined References (32)

PMID Year Title