Property Summary

NCBI Gene PubMed Count 29
Grant Count 17
R01 Count 8
Funding $1,190,540.6
PubMed Score 1136.54
PubTator Score 509.68

Knowledge Summary

Patent

No data available

Expression

Gene RIF (10)

PMID Text
26660537 motilin-induced phase III contractions signal hunger in healthy subjects and that this system is disturbed in morbidly obese patients--{REVIEW}
22632857 Motilin stimulates growth hormone secretion and regulates interdigestive migrating contractions and fasting motor patterns in the gastrointestinal tract. [REVIEW]
21771971 Motilin may directly influence adipocyte functions by stimulating energy storage.
20338210 Ghrelin covaried with motilin in plasma in irritable bowel syndrome (IBS) but not in plasma from healthy subjects. This suggests the two peptides act together in IBS.
19851445 Observational study of gene-disease association. (HuGE Navigator)
18609694 About 35.9% of the patients with a T tube after cholecystectomy and choledochotomy have duodenal-biliary reflux. Most of them have sphincter of Oddi hypomotility and the decreased level of plasma motilin and serum gastrin.
18358279 Observational study of gene-disease association. (HuGE Navigator)
18234640 The abnormal excretion of hormonal factors is closely related to gallstone formation
17595255 Ghrelin and motilin are cosecreted from a prominent endocrine cell population in the small intestine.
12732349 Plasma levels of motilin were studied in 16 untreated Celiac disease patients and in an age-matched control group of 18 healthy subjects by radioimmunoassay and by high-performance liquid chromatography (HPLC).

AA Sequence

MVSRKAVAALLVVHVAAMLASQTEAFVPIFTYGELQRMQEKERNKGQKKSLSVWQRSGEEGPVDPAEPIR      1 - 70
EEENEMIKLTAPLEIGMRMNSRQLEKYPATLEGLLSEMLPQHAAK                              71 - 115
//

Text Mined References (31)

PMID Year Title
26660537 2016 Redefining the functional roles of the gastrointestinal migrating motor complex and motilin in small bacterial overgrowth and hunger signaling.
23850713 2014 Genome-wide association study of Crohn's disease in Koreans revealed three new susceptibility loci and common attributes of genetic susceptibility across ethnic populations.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22632857 2012 Ghrelin and motilin in the gastrointestinal system.
22005931 2012 Genome-wide association analysis of age-at-onset in Alzheimer's disease.
21771971 2011 Motilin stimulates preadipocyte proliferation and differentiation and adipocyte lipid storage.
20558539 2010 Common genetic variants associate with serum phosphorus concentration.
20338210 2010 Covariation of plasma ghrelin and motilin in irritable bowel syndrome.
19851445 2009 High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions.
19553259 2009 Common body mass index-associated variants confer risk of extreme obesity.
More...