Property Summary

NCBI Gene PubMed Count 1,657
PubMed Score 6324.29
PubTator Score 5377.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Kidney cancer 2613 0.0 0.7
Stomach cancer 30 0.0 1.0
Disease Target Count Z-score Confidence
Breast cancer 3578 0.0 1.0

Expression

  Differential Expression (17)

Disease log2 FC p
ovarian cancer 2.500 3.5e-03
ductal carcinoma in situ 3.400 1.4e-02
ulcerative colitis -1.200 4.8e-03
adult high grade glioma 1.300 2.4e-02
Astrocytoma, Pilocytic 2.900 1.7e-07
atypical teratoid / rhabdoid tumor 2.400 1.4e-02
group 4 medulloblastoma 1.900 4.6e-04
interstitial cystitis -1.900 1.8e-02
invasive ductal carcinoma 2.000 3.3e-03
lung adenocarcinoma 1.300 1.4e-05
lung cancer 1.100 4.9e-03
lung carcinoma 1.300 1.1e-22
malignant mesothelioma 1.500 1.9e-06
non-small cell lung cancer 1.678 9.3e-12
osteosarcoma -4.624 3.6e-07
primitive neuroectodermal tumor 1.800 3.1e-02
psoriasis 1.900 2.8e-04
See source...

Gene RIF (1593)

AA Sequence

MGPWSRSLSALLLLLQVSSWLCQEPEPCHPGFDAESYTFTVPRRHLERGRVLGRVNFEDCTGRQRTAYFS      1 - 70
LDTRFKVGTDGVITVKRPLRFHNPQIHFLVYAWDSTYRKFSTKVTLNTVGHHHRPPPHQASVSGIQAELL     71 - 140
TFPNSSPGLRRQKRDWVIPPISCPENEKGPFPKNLVQIKSNKDKEGKVFYSITGQGADTPPVGVFIIERE    141 - 210
TGWLKVTEPLDRERIATYTLFSHAVSSNGNAVEDPMEILITVTDQNDNKPEFTQEVFKGSVMEGALPGTS    211 - 280
VMEVTATDADDDVNTYNAAIAYTILSQDPELPDKNMFTINRNTGVISVVTTGLDRESFPTYTLVVQAADL    281 - 350
QGEGLSTTATAVITVTDTNDNPPIFNPTTYKGQVPENEANVVITTLKVTDADAPNTPAWEAVYTILNDDG    351 - 420
GQFVVTTNPVNNDGILKTAKGLDFEAKQQYILHVAVTNVVPFEVSLTTSTATVTVDVLDVNEAPIFVPPE    421 - 490
KRVEVSEDFGVGQEITSYTAQEPDTFMEQKITYRIWRDTANWLEINPDTGAISTRAELDREDFEHVKNST    491 - 560
YTALIIATDNGSPVATGTGTLLLILSDVNDNAPIPEPRTIFFCERNPKPQVINIIDADLPPNTSPFTAEL    561 - 630
THGASANWTIQYNDPTQESIILKPKMALEVGDYKINLKLMDNQNKDQVTTLEVSVCDCEGAAGVCRKAQP    631 - 700
VEAGLQIPAILGILGGILALLILILLLLLFLRRRAVVKEPLLPPEDDTRDNVYYYDEEGGGEEDQDFDLS    701 - 770
QLHRGLDARPEVTRNDVAPTLMSVPRYLPRPANPDEIGNFIDENLKAADTDPTAPPYDSLLVFDYEGSGS    771 - 840
EAASLSSLNSSESDKDQDYDYLNEWGNRFKKLADMYGGGEDD                                841 - 882
//

Text Mined References (1669)

PMID Year Title