Property Summary

NCBI Gene PubMed Count 23
Grant Count 142
R01 Count 87
Funding $17,725,383.54
PubMed Score 27.16
PubTator Score 35.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -3.772 0.000
non diabetic and post-ischemic heart fai... 2.100 0.006
psoriasis -1.300 0.000

Synonym

Accession P12829 D3DXJ7 P11783
Symbols GT1
ALC1
AMLC
PRO1957

Gene

Gene RIF (7)

PMID Text
27066836 a novel, heterozygous p.Glu11Lys mutation in the atrial-specific myosin light chain gene MYL4, caused atrial fibrillation.
25807286 A recessive frameshift mutation in MYL4 causes early-onset atrial fibrillation.
19794400 Treatment of human brain endothelial cells with Tat markedly elevates GTP-RhoA levels and the potential downstream effectors, such as myosin phosphatase target subunit 1 and myosin light chain
16106982 results demonstrate that the expression of hALC-1 could have a beneficial effect on the overloaded hypertrophied heart
10373429 NMR showed involvement of N-terminus and lysines 3 and 4 in interaction with actin. Mutations of these lysines (K3A,K4R,K4A,K4D) resulted in altered actin binding and actin activated MgATPase. Mutation of Ala-1 to val had no effect on binding or kinetics.
9738905 The N-terminus of this protein is an actin binding site.
9000508 The (Ala-Pro) rich part of this protein acts as a "spacer arm" responsible for correct positioning of the N-terminal actin binding site.

AA Sequence

MAPKKPEPKKEAAKPAPAPAPAPAPAPAPAPEAPKEPAFDPKSVKIDFTADQIEEFKEAFSLFDRTPTGE      1 - 70
MKITYGQCGDVLRALGQNPTNAEVLRVLGKPKPEEMNVKMLDFETFLPILQHISRNKEQGTYEDFVEGLR     71 - 140
VFDKESNGTVMGAELRHVLATLGEKMTEAEVEQLLAGQEDANGCINYEAFVKHIMSG                 141 - 197
//

Text Mined References (24)

PMID Year Title
27066836 2016 A mutation in the atrial-specific myosin light chain gene (MYL4) causes familial atrial fibrillation.
25807286 2015 Large-scale whole-genome sequencing of the Icelandic population.
21269460 2011 Initial characterization of the human central proteome.
16675844 2006 Minigenes encoding N-terminal domains of human cardiac myosin light chain-1 improve heart function of transgenic rats.
16381901 2006 The LIFEdb database in 2006.
16106982 2005 Human atrial myosin light chain 1 expression attenuates heart failure.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14985854 2004 Functional characterization of the human atrial essential myosin light chain (hALC-1) in a transgenic rat model.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...