Property Summary

NCBI Gene PubMed Count 23
PubMed Score 27.16
PubTator Score 35.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Hypertrophic Cardiomyopathy 56
Disease Target Count P-value
psoriasis 6685 9.42748141481524E-11
osteosarcoma 7933 9.78159238792223E-6
non diabetic and post-ischemic heart failure 200 0.00635779814086174

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -3.772 0.000
non diabetic and post-ischemic heart fai... 2.100 0.006
psoriasis -1.300 0.000

Synonym

Accession P12829 D3DXJ7 P11783
Symbols GT1
ALC1
AMLC
PRO1957

Gene

  Ortholog (11)

Gene RIF (7)

PMID Text
27066836 a novel, heterozygous p.Glu11Lys mutation in the atrial-specific myosin light chain gene MYL4, caused atrial fibrillation.
25807286 A recessive frameshift mutation in MYL4 causes early-onset atrial fibrillation.
19794400 Treatment of human brain endothelial cells with Tat markedly elevates GTP-RhoA levels and the potential downstream effectors, such as myosin phosphatase target subunit 1 and myosin light chain
16106982 results demonstrate that the expression of hALC-1 could have a beneficial effect on the overloaded hypertrophied heart
10373429 NMR showed involvement of N-terminus and lysines 3 and 4 in interaction with actin. Mutations of these lysines (K3A,K4R,K4A,K4D) resulted in altered actin binding and actin activated MgATPase. Mutation of Ala-1 to val had no effect on binding or kinetics.
9738905 The N-terminus of this protein is an actin binding site.
9000508 The (Ala-Pro) rich part of this protein acts as a "spacer arm" responsible for correct positioning of the N-terminal actin binding site.

AA Sequence

MAPKKPEPKKEAAKPAPAPAPAPAPAPAPAPEAPKEPAFDPKSVKIDFTADQIEEFKEAFSLFDRTPTGE      1 - 70
MKITYGQCGDVLRALGQNPTNAEVLRVLGKPKPEEMNVKMLDFETFLPILQHISRNKEQGTYEDFVEGLR     71 - 140
VFDKESNGTVMGAELRHVLATLGEKMTEAEVEQLLAGQEDANGCINYEAFVKHIMSG                 141 - 197
//

Text Mined References (24)

PMID Year Title
27066836 2016 A mutation in the atrial-specific myosin light chain gene (MYL4) causes familial atrial fibrillation.
25807286 2015 Large-scale whole-genome sequencing of the Icelandic population.
21269460 2011 Initial characterization of the human central proteome.
16675844 2006 Minigenes encoding N-terminal domains of human cardiac myosin light chain-1 improve heart function of transgenic rats.
16381901 2006 The LIFEdb database in 2006.
16106982 2005 Human atrial myosin light chain 1 expression attenuates heart failure.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14985854 2004 Functional characterization of the human atrial essential myosin light chain (hALC-1) in a transgenic rat model.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...