Property Summary

Ligand Count 326
NCBI Gene PubMed Count 2,407
PubMed Score 30363.80
PubTator Score 16082.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Hypertension 396 8.485 4.0
Coronary artery disease 268 7.63 3.8
Adenocarcinoma 122 0.0 0.0
Albuminuria 21 0.0 0.0
Allanson Pantzar McLeod syndrome 4 0.0 0.0
Alzheimer Disease 83 0.0 0.0
Arrhythmias, Cardiac 19 0.0 0.0
Atrial Fibrillation 124 0.0 0.0
Autistic Disorder 364 0.0 0.0
Berylliosis 28 0.0 0.0
Brain Ischemia 110 0.0 0.0
Carcinoma, Hepatocellular 228 0.0 0.0
Cardiovascular Diseases 59 0.0 0.0
Cerebral Hemorrhage 42 0.0 0.0
Coronary Disease 25 0.0 0.0
Coronary Restenosis 8 0.0 0.0
Cough 25 0.0 0.0
Death, Sudden 2 0.0 0.0
Diabetes Mellitus, Experimental 108 0.0 0.0
Diabetic Nephropathies 37 0.0 0.0
Drug Hypersensitivity 34 0.0 0.0
Gaucher Disease 4 0.0 0.0
Genetic Predisposition to Disease 27 0.0 0.0
Glomerulonephritis, IGA 34 0.0 0.0
Glycogen Storage Disease Type V 2 0.0 0.0
Heart failure 162 0.0 0.0
Hypertension, Pulmonary 37 0.0 0.0
Hypertrophy, Left Ventricular 24 0.0 0.0
Hypotension 82 0.0 0.0
Infant, Premature, Diseases 1 0.0 0.0
Infertility, Male 46 0.0 0.0
Kidney Diseases 114 0.0 0.0
Kidney Failure, Chronic 46 0.0 0.0
Lung Neoplasms 232 0.0 0.0
Lung diseases 50 0.0 0.0
MICROVASCULAR COMPLICATIONS OF DIABETES, SUSCEPTIBILITY TO, 3 1 0.0 0.0
Meningococcal Infections 4 0.0 0.0
Neoplasm Metastasis 168 0.0 0.0
Non-alcoholic Fatty Liver Disease 42 0.0 0.0
Pneumonia, Viral 1 0.0 0.0
Pre-Eclampsia 68 0.0 0.0
Prostatic Neoplasms 495 0.0 0.0
Psychoses, Substance-Induced 17 0.0 0.0
RENAL TUBULAR DYSGENESIS 4 0.0 0.0
Renal Insufficiency 90 0.0 0.0
Respiratory Tract Diseases 6 0.0 0.0
Severe acute respiratory syndrome 27 0.0 0.0
Staphylococcal Infections 5 0.0 0.0
Stomach Neoplasms 300 0.0 0.0
Stroke 33 0.0 0.0
Vascular System Injuries 9 0.0 0.0
Weight Gain 100 0.0 0.0
Disease Target Count P-value
non-small cell lung cancer 2890 6.8e-17
lung adenocarcinoma 2716 1.1e-10
facioscapulohumeral dystrophy 288 4.0e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Kidney disease 430 7.518 3.8
Heart disease 306 7.464 3.7
sarcoidosis 370 7.064 3.5
diabetes mellitus 1728 6.992 3.5
Angioedema 38 6.617 3.3
Cerebrovascular disease 238 6.449 3.2
Atherosclerosis 291 5.587 2.8
Lung disease 142 5.381 2.7
Lipid metabolism disorder 114 4.794 2.4
Obesity 678 4.643 2.3
Anemia 365 4.472 2.2
Dementia 175 4.416 2.2
Peripheral vascular disease 87 4.275 2.1
Hyperglycemia 137 4.267 2.1
Uveitis 103 4.194 2.1
Connective tissue disease 62 4.183 2.1
Diabetic retinopathy 56 4.111 2.1
Cancer 2499 4.107 2.1
Renal artery disease 3 4.104 2.1
Hypersensitivity reaction type II disease 253 4.088 2.0
Hypokalemia 52 3.877 1.9
Asthma 385 3.83 1.9
Peripheral artery disease 10 3.731 1.9
Impotence 46 3.72 1.9
Urinary tract obstruction 11 3.7 1.8
Intermittent claudication 20 3.692 1.8
Hyperaldosteronism 35 3.655 1.8
Neuropathy 261 3.576 1.8
Exanthem 37 3.535 1.8
Transient Cerebral Ischemia 25 3.527 1.8
Liver disease 237 3.474 1.7
Allergic hypersensitivity disease 126 3.433 1.7
Gaucher's disease 26 3.423 1.7
Conn's syndrome 22 3.417 1.7
Aortic aneurysm 38 3.409 1.7
Urticaria 67 3.381 1.7
C1 inhibitor deficiency 8 3.375 1.7
Autosomal dominant polycystic kidney disease 31 3.299 1.6
Migraine 83 3.282 1.6
tuberculosis 2010 3.24 1.6
Vasculitis 80 3.202 1.6
Hyperinsulinism 133 3.181 1.6
Substance abuse 59 3.131 1.6
Choroiditis 5 3.118 1.6
Hypertensive encephalopathy 3 3.116 1.6
Hypercalcemia 59 3.067 1.5
Lymphatic system disease 15 3.041 1.5
Alport syndrome 21 3.002 1.5
Disease Target Count
Kidney Failure 111
Renal dysplasia 28

Expression

  Differential Expression (3)

Disease log2 FC p
facioscapulohumeral dystrophy 1.800 4.0e-02
lung adenocarcinoma -1.500 1.1e-10
non-small cell lung cancer -1.692 6.8e-17

Gene RIF (2870)

AA Sequence

MGAASGRRGPGLLLPLPLLLLLPPQPALALDPGLQPGNFSADEAGAQLFAQSYNSSAEQVLFQSVAASWA      1 - 70
HDTNITAENARRQEEAALLSQEFAEAWGQKAKELYEPIWQNFTDPQLRRIIGAVRTLGSANLPLAKRQQY     71 - 140
NALLSNMSRIYSTAKVCLPNKTATCWSLDPDLTNILASSRSYAMLLFAWEGWHNAAGIPLKPLYEDFTAL    141 - 210
SNEAYKQDGFTDTGAYWRSWYNSPTFEDDLEHLYQQLEPLYLNLHAFVRRALHRRYGDRYINLRGPIPAH    211 - 280
LLGDMWAQSWENIYDMVVPFPDKPNLDVTSTMLQQGWNATHMFRVAEEFFTSLELSPMPPEFWEGSMLEK    281 - 350
PADGREVVCHASAWDFYNRKDFRIKQCTRVTMDQLSTVHHEMGHIQYYLQYKDLPVSLRRGANPGFHEAI    351 - 420
GDVLALSVSTPEHLHKIGLLDRVTNDTESDINYLLKMALEKIAFLPFGYLVDQWRWGVFSGRTPPSRYNF    421 - 490
DWWYLRTKYQGICPPVTRNETHFDAGAKFHVPNVTPYIRYFVSFVLQFQFHEALCKEAGYEGPLHQCDIY    491 - 560
RSTKAGAKLRKVLQAGSSRPWQEVLKDMVGLDALDAQPLLKYFQPVTQWLQEQNQQNGEVLGWPEYQWHP    561 - 630
PLPDNYPEGIDLVTDEAEASKFVEEYDRTSQVVWNEYAEANWNYNTNITTETSKILLQKNMQIANHTLKY    631 - 700
GTQARKFDVNQLQNTTIKRIIKKVQDLERAALPAQELEEYNKILLDMETTYSVATVCHPNGSCLQLEPDL    701 - 770
TNVMATSRKYEDLLWAWEGWRDKAGRAILQFYPKYVELINQAARLNGYVDAGDSWRSMYETPSLEQDLER    771 - 840
LFQELQPLYLNLHAYVRRALHRHYGAQHINLEGPIPAHLLGNMWAQTWSNIYDLVVPFPSAPSMDTTEAM    841 - 910
LKQGWTPRRMFKEADDFFTSLGLLPVPPEFWNKSMLEKPTDGREVVCHASAWDFYNGKDFRIKQCTTVNL    911 - 980
EDLVVAHHEMGHIQYFMQYKDLPVALREGANPGFHEAIGDVLALSVSTPKHLHSLNLLSSEGGSDEHDIN    981 - 1050
FLMKMALDKIAFIPFSYLVDQWRWRVFDGSITKENYNQEWWSLRLKYQGLCPPVPRTQGDFDPGAKFHIP   1051 - 1120
SSVPYIRYFVSFIIQFQFHEALCQAAGHTGPLHKCDIYQSKEAGQRLATAMKLGFSRPWPEAMQLITGQP   1121 - 1190
NMSASAMLSYFKPLLDWLRTENELHGEKLGWPQYNWTPNSARSEGPLPDSGRVSFLGLDLDAQQARVGQW   1191 - 1260
LLLFLGIALLVATLGLSQRLFSIRHRSLHRHSHGPQFGSEVELRHS                           1261 - 1306
//

Text Mined References (2416)

PMID Year Title