Property Summary

NCBI Gene PubMed Count 126
Grant Count 6
R01 Count 6
Funding $701,746.58
PubMed Score 48.34
PubTator Score 660.23

Knowledge Summary

Patent

No data available

Expression

Gene RIF (48)

PMID Text
26879394 Several dominantly inherited congenital macrothrombocytopenia-associated mutations that are located within the actinin-1 actin-binding domain cause increased binding of actinin-1 to actin filaments and enhance filament bundling in vitro.
26854759 The authors show that the microtubule binding protein EB1 (end-binding protein 1), a key regulator of microtubule dynamics, can bind directly to filamentous actin (F-actin) F-actin.
26609810 Drp1 is in dynamic equilibrium on mitochondria in a fission-independent manner, and that fission factors such as actin filaments target productive oligomerization to fission sites.
26096820 Host cortactin, PKD1 and actin are recruited by Trypanosoma cruzi extracellular amastigotes based on experiments in fixed and live cells by time lapse confocal microscopy.
26071203 Data indicate that alpha-actinin (110 kDa) autoantibody was characterized as a major target in lupus nephritis (LN) patients positive for Anti-membrane autoantibodies (MbA).
25431851 ACTN1 determines the motility of keratinocytes by regulating the organization of the actin cytoskeleton, focal adhesion, and hemidesmosome proteins complexes, thereby modulating cell speed, lamellipodial dynamics, and directed migration
25429109 ArgBP2 interaction with alpha-actinin and actin stress fibers inhibits cell migration
25361813 ACTN1-related thrombocytopenia is characterized by mild course with platelet macrocytosis and low risk for bleeding.
24069336 A missense mutation in the alpha-actinin 1 gene (ACTN1) is the cause of autosomal dominant macrothrombocytopenia in a large French family.
23664615 We conclude that alpha-actinin stabilizes Ca(V)1.2 at the plasma membrane and that its displacement by calcium-calmodulin triggers calcium-induced endocytosis of Ca(V)1.2, thus providing an important negative feedback mechanism for calcium influx.
More...

AA Sequence

MDHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRDGLKLMLLLE      1 - 70
VISGERLAKPERGKMRVHKISNVNKALDFIASKGVKLVSIGAEEIVDGNVKMTLGMIWTIILRFAIQDIS     71 - 140
VEETSAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGFCALIHRHRPELIDYGKLRKDDPLTNLNTAFD    141 - 210
VAEKYLDIPKMLDAEDIVGTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEQLMEDYE    211 - 280
KLASDLLEWIRRTIPWLENRVPENTMHAMQQKLEDFRDYRRLHKPPKVQEKCQLEINFNTLQTKLRLSNR    281 - 350
PAFMPSEGRMVSDINNAWGCLEQVEKGYEEWLLNEIRRLERLDHLAEKFRQKASIHEAWTDGKEAMLRQK    351 - 420
DYETATLSEIKALLKKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSPSVNARCQKICDQWDNLGALT    421 - 490
QKRREALERTEKLLETIDQLYLEYAKRAAPFNNWMEGAMEDLQDTFIVHTIEEIQGLTTAHEQFKATLPD    491 - 560
ADKERLAILGIHNEVSKIVQTYHVNMAGTNPYTTITPQEINGKWDHVRQLVPRRDQALTEEHARQQHNER    561 - 630
LRKQFGAQANVIGPWIQTKMEEIGRISIEMHGTLEDQLSHLRQYEKSIVNYKPKIDQLEGDHQLIQEALI    631 - 700
FDNKHTNYTMEHIRVGWEQLLTTIARTINEVENQILTRDAKGISQEQMNEFRASFNHFDRDHSGTLGPEE    701 - 770
FKACLISLGYDIGNDPQGEAEFARIMSIVDPNRLGVVTFQAFIDFMSRETADTDTADQVMASFKILAGDK    771 - 840
NYITMDELRRELPPDQAEYCIARMAPYTGPDSVPGALDYMSFSTALYGESDL                      841 - 892
//

Text Mined References (133)

PMID Year Title
26879394 2016 Congenital macrothrombocytopenia-linked mutations in the actin-binding domain of ?-actinin-1 enhance F-actin association.
26854759 2016 Interactions between the Microtubule Binding Protein EB1 and F-Actin.
26609810 2015 Actin filaments target the oligomeric maturation of the dynamin GTPase Drp1 to mitochondrial fission sites.
26096820 2015 Trypanosoma cruzi extracellular amastigotes trigger the protein kinase D1-cortactin-actin pathway during cell invasion.
26071203 2015 Anti-alpha-actinin antibodies are part of the anti-cell membrane antibody spectrum that characterize patients with lupus nephritis.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25431851 2015 Alpha actinin-1 regulates cell-matrix adhesion organization in keratinocytes: consequences for skin cell motility.
25429109 2015 Arg kinase-binding protein 2 (ArgBP2) interaction with ?-actinin and actin stress fibers inhibits cell migration.
25416956 2014 A proteome-scale map of the human interactome network.
25361813 2015 ACTN1-related thrombocytopenia: identification of novel families for phenotypic characterization.
More...