Property Summary

NCBI Gene PubMed Count 134
PubMed Score 54.57
PubTator Score 660.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
substance-related disorder 162 0.0 0.9
Disease Target Count Z-score Confidence
thrombocytopenia-absent radius syndrome 6 3.541 1.8
Disease Target Count
Platelet-type bleeding disorder 15 1

Expression

  Differential Expression (26)

Disease log2 FC p
acute quadriplegic myopathy 1.321 3.4e-05
astrocytic glioma -2.100 4.9e-02
autosomal dominant Emery-Dreifuss muscul... 1.630 2.2e-03
Becker muscular dystrophy 1.006 1.8e-02
chronic lymphosyte leukemia -1.300 9.5e-09
colon cancer -1.200 1.2e-02
Common variable immunodeficiency -1.526 2.4e-02
COPD -1.100 3.1e-04
dermatomyositis 1.600 1.2e-02
Duchenne muscular dystrophy 1.869 6.8e-11
gastric carcinoma 1.700 1.1e-02
glioblastoma 2.100 1.0e-02
group 4 medulloblastoma -1.600 9.5e-04
juvenile dermatomyositis 1.746 2.6e-11
limb girdle muscular dystrophy 2A 1.016 3.3e-04
lung adenocarcinoma 1.172 4.0e-06
lung cancer 1.200 2.2e-03
medulloblastoma, large-cell -1.700 2.5e-04
oligodendroglioma -1.900 1.7e-02
ovarian cancer 3.200 3.3e-07
pancreatic cancer 1.200 1.6e-04
pancreatic carcinoma 1.200 1.6e-04
posterior fossa group A ependymoma 1.200 3.8e-05
primary pancreatic ductal adenocarcinoma 1.722 1.5e-03
subependymal giant cell astrocytoma 2.214 3.2e-02
ulcerative colitis 1.200 5.2e-08

 CSPA Cell Line (3)

Gene RIF (54)

AA Sequence

MDHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRDGLKLMLLLE      1 - 70
VISGERLAKPERGKMRVHKISNVNKALDFIASKGVKLVSIGAEEIVDGNVKMTLGMIWTIILRFAIQDIS     71 - 140
VEETSAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGFCALIHRHRPELIDYGKLRKDDPLTNLNTAFD    141 - 210
VAEKYLDIPKMLDAEDIVGTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEQLMEDYE    211 - 280
KLASDLLEWIRRTIPWLENRVPENTMHAMQQKLEDFRDYRRLHKPPKVQEKCQLEINFNTLQTKLRLSNR    281 - 350
PAFMPSEGRMVSDINNAWGCLEQVEKGYEEWLLNEIRRLERLDHLAEKFRQKASIHEAWTDGKEAMLRQK    351 - 420
DYETATLSEIKALLKKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSPSVNARCQKICDQWDNLGALT    421 - 490
QKRREALERTEKLLETIDQLYLEYAKRAAPFNNWMEGAMEDLQDTFIVHTIEEIQGLTTAHEQFKATLPD    491 - 560
ADKERLAILGIHNEVSKIVQTYHVNMAGTNPYTTITPQEINGKWDHVRQLVPRRDQALTEEHARQQHNER    561 - 630
LRKQFGAQANVIGPWIQTKMEEIGRISIEMHGTLEDQLSHLRQYEKSIVNYKPKIDQLEGDHQLIQEALI    631 - 700
FDNKHTNYTMEHIRVGWEQLLTTIARTINEVENQILTRDAKGISQEQMNEFRASFNHFDRDHSGTLGPEE    701 - 770
FKACLISLGYDIGNDPQGEAEFARIMSIVDPNRLGVVTFQAFIDFMSRETADTDTADQVMASFKILAGDK    771 - 840
NYITMDELRRELPPDQAEYCIARMAPYTGPDSVPGALDYMSFSTALYGESDL                      841 - 892
//

Text Mined References (141)

PMID Year Title