Property Summary

NCBI Gene PubMed Count 75
PubMed Score 173.01
PubTator Score 84.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
chronic lymphosyte leukemia -1.200 1.5e-05
chronic rhinosinusitis -1.104 1.6e-02
colon cancer 1.700 2.2e-02
diabetes mellitus -1.500 1.8e-02
gastric cancer -1.200 6.8e-03
glioblastoma 1.400 1.1e-03
inflammatory breast cancer 1.100 1.4e-02
intraductal papillary-mucinous adenoma (... 1.300 4.7e-02
lung cancer -1.500 1.9e-02
lung carcinoma -1.500 7.3e-19
osteosarcoma 1.658 7.2e-03
pancreatic cancer 1.300 1.8e-02
pancreatic ductal adenocarcinoma liver m... 1.390 1.5e-02
Pick disease 1.300 2.9e-05
pituitary cancer -1.700 6.4e-04
primary Sjogren syndrome 1.200 2.0e-02
progressive supranuclear palsy 1.200 2.6e-02
subependymal giant cell astrocytoma 1.904 3.6e-02
tuberculosis -3.800 4.0e-08
ulcerative colitis 1.600 3.7e-07
X-linked cerebral adrenoleukodystrophy 1.600 4.5e-02

Protein-protein Interaction (2)

Gene RIF (48)

AA Sequence

MENLQTNFSLVQGSTKKLNGMGDDGSPPAKKMITDIHANGKTINKVPTVKKEHLDDYGEAPVETDGEHVK      1 - 70
RTCTSVPETLHLNPSLKHTLAQFHLSSQSSLGGPAAFSARHSQESMSPTVFLPLPSPQVLPGPLLIPSDS     71 - 140
STELTQTVLEGESISCFQVGGEKRLCLPQVLNSVLREFTLQQINTVCDELYIYCSRCTSDQLHILKVLGI    141 - 210
LPFNAPSCGLITLTDAQRLCNALLRPRTFPQNGSVLPAKSSLAQLKETGSAFEVEHECLGKCQGLFAPQF    211 - 280
YVQPDAPCIQCLECCGMFAPQTFVMHSHRSPDKRTCHWGFESAKWHCYLHVNQKYLGTPEEKKLKIILEE    281 - 350
MKEKFSMRSGKRNQSKTDAPSGMELQSWYPVIKQEGDHVSQTHSFLHPSYYLYMCDKVVAPNVSLTSAVS    351 - 420
QSKELTKTEASKSISRQSEKAHSSGKLQKTVSYPDVSLEEQEKMDLKTSRELCSRLDASISNNSTSKRKS    421 - 490
ESATCNLVRDINKVGIGLVAAASSPLLVKDVICEDDKGKIMEEVMRTYLKQQEKLNLILQKKQQLQMEVK    491 - 560
MLSSSKSMKELTEEQQNLQKELESLQNEHAQRMEEFYVEQKDLEKKLEQIMKQKCTCDSNLEKDKEAEYA    561 - 630
GQLAELRQRLDHAEADRQELQDELRQEREARQKLEMMIKELKLQILKSSKTAKE                    631 - 684
//

Text Mined References (81)

PMID Year Title