Property Summary

NCBI Gene PubMed Count 70
PubMed Score 140.84
PubTator Score 84.43

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
lung carcinoma 2844 7.26323997694128E-19
tuberculosis 1563 4.03321136251739E-8
ulcerative colitis 2087 3.68476346123493E-7
chronic lymphosyte leukemia 232 1.46168226145839E-5
Pick disease 1893 2.87702321720015E-5
pituitary cancer 1972 6.43432427238972E-4
glioblastoma 5572 0.00114222147024317
gastric carcinoma 832 0.00550191821275703
primary pancreatic ductal adenocarcinoma 1271 0.00596489775416137
osteosarcoma 7933 0.00722495102828268
inflammatory breast cancer 404 0.0144873595095567
chronic rhinosinusitis 512 0.0164218689158878
diabetes mellitus 1663 0.0179041216896466
pancreatic cancer 2300 0.0179234311051862
lung cancer 4473 0.0194414686094208
primary Sjogren syndrome 789 0.0203205252261071
colon cancer 1475 0.0218446147927136
progressive supranuclear palsy 674 0.0255177653781677
subependymal giant cell astrocytoma 2287 0.0355597487541582
X-linked cerebral adrenoleukodystrophy 115 0.0446396507794023
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0466393135735076

Expression

  Differential Expression (21)

Synonym

Accession P12757 A6NGT1 B4DT50 O00464 P12756 Q07501
Symbols SNO
SnoA
SnoI
SnoN

Gene

PANTHER Protein Class (1)

PDB

3EQ5  

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (45)

PMID Text
26743567 the findings of this study demonstrate that the downregulation of SnoN expression in hRPTECs under high-glucose conditions is mediated by the increased expression of Smurf2 through the TGF-b1/Smad signaling pathway.
25907906 RNAi-mediated downregulation of SnoN effectively inhibited proliferation and enhanced apoptosis of pancreatic cells.
25749039 SKIL knockdown led to growth arrest in PC-3 and LNCaP cell line models of prostate cancer, and its overexpression led to increased invasiveness in RWPE-1 cells.
25464936 Whole exome sequencing of the blood of the patient and both parents revealed a de novo germline SKIL mutation in the child that was not present in either parent
25059663 Data indicate that tripartite motif containing 33 protein TIF1gamma promotes sumoylation of SKI-like proto-oncogene protein SnoN1 and regulates epithelial-mesenchymal transition (EMT).
24637302 The results indicate that protein ubiquitination promotes megakaryopoiesis via degrading SnoN, an inhibitor of CD61 expression, strengths the roles of ubiquitination in cellular differentiation.
23832742 High SnoN expression is associated with metastasis in breast cancer.
23764425 these studies identify TLOC1 and SKIL as driver genes at 3q26 and more broadly suggest that cooperating genes may be coamplified in other regions with somatic copy number gain.
23621864 Phospholipid Scramblase 1, an interferon-regulated gene located at 3q23, is regulated by SnoN/SkiL in ovarian cancer cells.
23446947 SnoNspecific siRNA is capable of effectively inhibiting the expression of SnoN in human HepG2 cells, and the downregulation of SnoN expression induces growth inhibition and apoptosis
More...

AA Sequence

MENLQTNFSLVQGSTKKLNGMGDDGSPPAKKMITDIHANGKTINKVPTVKKEHLDDYGEAPVETDGEHVK      1 - 70
RTCTSVPETLHLNPSLKHTLAQFHLSSQSSLGGPAAFSARHSQESMSPTVFLPLPSPQVLPGPLLIPSDS     71 - 140
STELTQTVLEGESISCFQVGGEKRLCLPQVLNSVLREFTLQQINTVCDELYIYCSRCTSDQLHILKVLGI    141 - 210
LPFNAPSCGLITLTDAQRLCNALLRPRTFPQNGSVLPAKSSLAQLKETGSAFEVEHECLGKCQGLFAPQF    211 - 280
YVQPDAPCIQCLECCGMFAPQTFVMHSHRSPDKRTCHWGFESAKWHCYLHVNQKYLGTPEEKKLKIILEE    281 - 350
MKEKFSMRSGKRNQSKTDAPSGMELQSWYPVIKQEGDHVSQTHSFLHPSYYLYMCDKVVAPNVSLTSAVS    351 - 420
QSKELTKTEASKSISRQSEKAHSSGKLQKTVSYPDVSLEEQEKMDLKTSRELCSRLDASISNNSTSKRKS    421 - 490
ESATCNLVRDINKVGIGLVAAASSPLLVKDVICEDDKGKIMEEVMRTYLKQQEKLNLILQKKQQLQMEVK    491 - 560
MLSSSKSMKELTEEQQNLQKELESLQNEHAQRMEEFYVEQKDLEKKLEQIMKQKCTCDSNLEKDKEAEYA    561 - 630
GQLAELRQRLDHAEADRQELQDELRQEREARQKLEMMIKELKLQILKSSKTAKE                    631 - 684
//

Text Mined References (75)

PMID Year Title
26743567 2016 The downregulation of SnoN expression in human renal proximal tubule epithelial cells under high-glucose conditions is mediated by an increase in Smurf2 expression through TGF-?1 signaling.
25907906 2015 The influence of SnoN gene silencing by siRNA on the cell proliferation and apoptosis of human pancreatic cancer cells.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25749039 2015 Recurrent SKIL-activating rearrangements in ETS-negative prostate cancer.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
25464936 Intraductal papillary mucinous neoplasm in a neonate with congenital hyperinsulinism and a de novo germline SKIL gene mutation.
25416956 2014 A proteome-scale map of the human interactome network.
25059663 2014 TIF1? protein regulates epithelial-mesenchymal transition by operating as a small ubiquitin-like modifier (SUMO) E3 ligase for the transcriptional regulator SnoN1.
24637302 2014 PMA induces SnoN proteolysis and CD61 expression through an autocrine mechanism.
23832742 2013 Cooperative involvement of NFAT and SnoN mediates transforming growth factor-? (TGF-?) induced EMT in metastatic breast cancer (MDA-MB 231) cells.
More...