Property Summary

NCBI Gene PubMed Count 95
Grant Count 16
R01 Count 16
Funding $1,692,648.07
PubMed Score 58.59
PubTator Score 1052.73

Knowledge Summary

Patent

No data available

Expression

 GWAS Trait (1)

Gene RIF (65)

PMID Text
26138431 Overexpression of Ski wild type, but not S326D and S383D mutants inhibited centrosome amplification and cellular transformation induced by AURKA.
25955797 our findings suggest that Ski represses TGF-b-induced EMT and invasion by inhibiting SMAD-dependent signaling in non-small cell lung cancer
25670202 Ski regulates Hippo and TAZ signaling to suppress breast cancer progression.
24736733 Eight recurrent and three novel SKI mutations from eleven SGS patients were located in the R-SMAD binding domain, except for one in the DHD domain.
24641900 acetaldehyde up-regulates COL1A2 by modulating the role of Ski and the expression of SMADs 3, 4, and 7.
24011664 c-Ski is an important regulator in the activation of CAFs and may serve as a potential therapeutic target to block breast cancer progression.
23892090 The 1p36.33-1p36.32 deletion encompassing SKI may represents a previous undescribed microdeletion disorder.
23809940 Overall, these studies demonstrate altered Ski protein levels, degradation and localization in human papillomavirus16-transformed human keratinocytes and in cervical cancer.
23441061 Ski expression is a novel negative feedback mechanism acting on retinoic acid signaling
23103230 our findings show that in-frame mutations in exon 1 of SKI cause Shprintzen-Goldberg syndrome (SGS).
More...

AA Sequence

MEAAAGGRGCFQPHPGLQKTLEQFHLSSMSSLGGPAAFSARWAQEAYKKESAKEAGAAAVPAPVPAATEP      1 - 70
PPVLHLPAIQPPPPVLPGPFFMPSDRSTERCETVLEGETISCFVVGGEKRLCLPQILNSVLRDFSLQQIN     71 - 140
AVCDELHIYCSRCTADQLEILKVMGILPFSAPSCGLITKTDAERLCNALLYGGAYPPPCKKELAASLALG    141 - 210
LELSERSVRVYHECFGKCKGLLVPELYSSPSAACIQCLDCRLMYPPHKFVVHSHKALENRTCHWGFDSAN    211 - 280
WRAYILLSQDYTGKEEQARLGRCLDDVKEKFDYGNKYKRRVPRVSSEPPASIRPKTDDTSSQSPAPSEKD    281 - 350
KPSSWLRTLAGSSNKSLGCVHPRQRLSAFRPWSPAVSASEKELSPHLPALIRDSFYSYKSFETAVAPNVA    351 - 420
LAPPAQQKVVSSPPCAAAVSRAPEPLATCTQPRKRKLTVDTPGAPETLAPVAAPEEDKDSEAEVEVESRE    421 - 490
EFTSSLSSLSSPSFTSSSSAKDLGSPGARALPSAVPDAAAPADAPSGLEAELEHLRQALEGGLDTKEAKE    491 - 560
KFLHEVVKMRVKQEEKLSAALQAKRSLHQELEFLRVAKKEKLREATEAKRNLRKEIERLRAENEKKMKEA    561 - 630
NESRLRLKRELEQARQARVCDKGCEAGRLRAKYSAQIEDLQVKLQHAEADREQLRADLLREREAREHLEK    631 - 700
VVKELQEQLWPRARPEAAGSEGAAELEP                                              701 - 728
//

Text Mined References (98)

PMID Year Title
26138431 2016 The Ski Protein is Involved in the Transformation Pathway of Aurora Kinase A.
25955797 2015 Ski prevents TGF-?-induced EMT and cell invasion by repressing SMAD-dependent signaling in non-small cell lung cancer.
25670202 2015 Ski regulates Hippo and TAZ signaling to suppress breast cancer progression.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
24736733 2015 The SMAD-binding domain of SKI: a hotspot for de novo mutations causing Shprintzen-Goldberg syndrome.
24641900 2014 Mechanisms of action of acetaldehyde in the up-regulation of the human ?2(I) collagen gene in hepatic stellate cells: key roles of Ski, SMAD3, SMAD4, and SMAD7.
24357594 2014 De novo exon 1 missense mutations of SKI and Shprintzen-Goldberg syndrome: two new cases and a clinical review.
24011664 2013 c-Ski activates cancer-associated fibroblasts to regulate breast cancer cell invasion.
23892090 2013 576 kb deletion in 1p36.33-p36.32 containing SKI is associated with limb malformation, congenital heart disease and epilepsy.
23809940 2013 Ski protein levels increase during in vitro progression of HPV16-immortalized human keratinocytes and in cervical cancer.
More...