Property Summary

NCBI Gene PubMed Count 107
Grant Count 81
R01 Count 43
Funding $8,878,718.85
PubMed Score 1993.54
PubTator Score 714.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
Waldenstrons macroglobulinemia 2.181 0.027
osteosarcoma -6.557 0.000
diabetes mellitus 1.800 0.001
acute myeloid leukemia -2.300 0.004

Synonym

Accession P12724 Q4VBC1 Q8WTP7 Q8WZ62 Q9GZN9 ECP
Symbols ECP
RAF1
RNS3

Gene

PDB

1DYT   1H1H   1QMT   2KB5   2LVZ   4A2O   4A2Y   4OWZ   4OXB   4OXF   4X08  

Gene RIF (89)

PMID Text
26600485 Children in the acute-phase group showed higher ECP mRNA expression level than those in the stable-phase and healthy control groups, while the level in the stable-phase was markedly higher than that in the healthy control group.
25463127 drug eluting stent polymers increase eosinophil cationic protein levels following percutaneous coronary intervention independently of C-reactive protein
25354326 Around half of all variance in serum ECP is explained by genetic factors. Serum ECP is influenced by sex, BMI, and airway responsiveness. Serum ECP and airway responsiveness seem not to share genetic variance.
24814827 mRNA levels of eosinophil granule proteins, rather than sputum eosinophil%, may reflect airway hyperresponsiveness and airflow limitation.
24738159 report the prevalence of a common SNP in the eosinophil protein x/eosinophil-derived neurotoxin (EPX/EDN, RNase2) and the association with the cellular contents of EPX/EDN and ECP
24383969 Eosinophil cationic protein is not cytotoxic but enhances the growth of normal human dermal fibroblasts
24129707 eosinophil cationic protein levels can be used to diagnosis atopic dermatitis but cannot distinguish between intrinsic and extrinsic disease.
23841472 Effects of omalizumab on eosinophil cationic peptide, 25-hydroxyvitamin-D, IL-1beta and sCD200 in cases of Samter's syndrome
23786280 Eosinophil activation occurred in early and late responses after L-ASA NPT in upper airway mucosa of AERD patients, where ApoA1, alpha2M and CP as well as CysLT may be involved in eosinophilic inflammation.
23716047 The antimicrobial protein, Rnase 3, contributes to the host immune response against mycobacteria.
More...

AA Sequence

MVPKLFTSQICLLLLLGLMGVEGSLHARPPQFTRAQWFAIQHISLNPPRCTIAMRAINNYRWRCKNQNTF      1 - 70
LRTTFANVVNVCGNQSIRCPHNRTLNNCHRSRFRVPLLHCDLINPGAQNISNCTYADRPGRRFYVVACDN     71 - 140
RDPRDSPRYPVVPVHLDTTI                                                      141 - 160
//

Text Mined References (111)

PMID Year Title
26600485 2015 Eosinophil cationic protein mRNA expression in children with bronchial asthma.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25463127 2014 Permanent polymer of drug eluting stents increases eosinophil cationic protein levels following percutaneous coronary intervention independently of C-reactive protein.
25354326 2014 Genetic factors explain half of all variance in serum eosinophil cationic protein.
24814827 2014 Expression levels of eosinophil granule protein mRNAs in induced sputum reflect airway hyperresponsiveness and airflow limitation.
24738159 2014 The production of the eosinophil proteins ECP and EPX/EDN are regulated in a reciprocal manner.
24383969 2013 Cytokine expression in human dermal fibroblasts stimulated with eosinophil cationic protein measured by protein array.
24129707 2014 Utility of eosinophil cationic protein levels in the diagnosis of intrinsic atopic dermatitis.
23841472 2013 Effects of omalizumab on eosinophil cationic peptide, 25-hydroxyvitamin-D, IL-1? and sCD200 in cases of Samter's syndrome: 36 months follow-up.
23786280 2013 Eosinophil activation and novel mediators in the aspirin-induced nasal response in AERD.
More...