Property Summary

NCBI Gene PubMed Count 30
Grant Count 22
R01 Count 17
Funding $2,881,705.68
PubMed Score 121.89
PubTator Score 55.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma 1.522 0.009
lung cancer -4.100 0.000
colon cancer -4.700 0.000
interstitial cystitis -1.500 0.000
lung adenocarcinoma -1.100 0.000
ulcerative colitis -1.100 0.000
psoriasis -1.700 0.000

Gene RIF (13)

PMID Text
24993691 Methylation level in stool decreases dramatically following colorectal cancer resection
23127436 Bone morphogenic protein 3 signaling in the regulation of osteogenesis.
22303795 As an addition to PRKG2 and RASGEFIB genes, we propose to include BMP3 gene as the principal determinant of the observed common phenotype.
21628466 a critical link between HNF1A-MODY-induced alterations in Bmp-3 expression and insulin gene levels
21415150 Circulating bone morphogenetic protein 1-3 isoform increases renal fibrosis.
20734064 Observational study of gene-disease association. (HuGE Navigator)
20532035 Features supportive of positive selection in the BMP3 gene were found including the presence of an excess of nonsynonymous mutations in modern humans, and a significantly lower genetic diversity that deviates from neutrality
20238409 Data suggest that promotor region methylation of the BMP3 gene may cause gastric carcinoma in Chinese people.
20143330 These results demonstrate that BMP-3 stimulates mesenchymal stem cell proliferation via the TGF-beta/activin signaling pathway.
19453261 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MAGASRLLFLWLGCFCVSLAQGERPKPPFPELRKAVPGDRTAGGGPDSELQPQDKVSEHMLRLYDRYSTV      1 - 70
QAARTPGSLEGGSQPWRPRLLREGNTVRSFRAAAAETLERKGLYIFNLTSLTKSENILSATLYFCIGELG     71 - 140
NISLSCPVSGGCSHHAQRKHIQIDLSAWTLKFSRNQSQLLGHLSVDMAKSHRDIMSWLSKDITQLLRKAK    141 - 210
ENEEFLIGFNITSKGRQLPKRRLPFPEPYILVYANDAAISEPESVVSSLQGHRNFPTGTVPKWDSHIRAA    211 - 280
LSIERRKKRSTGVLLPLQNNELPGAEYQYKKDEVWEERKPYKTLQAQAPEKSKNKKKQRKGPHRKSQTLQ    281 - 350
FDEQTLKKARRKQWIEPRNCARRYLKVDFADIGWSEWIISPKSFDAYYCSGACQFPMPKSLKPSNHATIQ    351 - 420
SIVRAVGVVPGIPEPCCVPEKMSSLSILFFDENKNVVLKVYPNMTVESCACR                      421 - 472
//

Text Mined References (32)

PMID Year Title
24993691 2014 Stool methylated DNA markers decrease following colorectal cancer resection--implications for surveillance.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23449627 2013 Genome-wide association and longitudinal analyses reveal genetic loci linking pubertal height growth, pubertal timing and childhood adiposity.
23396134 2013 Genome-wide meta-analyses of multiancestry cohorts identify multiple new susceptibility loci for refractive error and myopia.
23127436 2012 Bone morphogenic protein 3 signaling in the regulation of osteogenesis.
22303795 2011 8.6Mb interstitial deletion of chromosome 4q13.3q21.23 in a boy with cognitive impairment, short stature, hearing loss, skeletal abnormalities and facial dysmorphism.
21628466 2011 Bone morphogenetic protein 3 controls insulin gene expression and is down-regulated in INS-1 cells inducibly expressing a hepatocyte nuclear factor 1A-maturity-onset diabetes of the young mutation.
21415150 2011 Circulating bone morphogenetic protein 1-3 isoform increases renal fibrosis.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20532035 2010 Evidence for positive selection on the Osteogenin (BMP3) gene in human populations.
More...