Property Summary

NCBI Gene PubMed Count 345
Grant Count 901
R01 Count 589
Funding $94,425,077.68
PubMed Score 1539.53
PubTator Score 730.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
interstitial lung disease 1.400 0.015
malignant mesothelioma 2.900 0.000
cutaneous lupus erythematosus -1.200 0.003
osteosarcoma 1.696 0.000
cystic fibrosis -1.948 0.000
atypical teratoid / rhabdoid tumor 2.000 0.024
lung cancer 3.500 0.000
colon cancer 1.600 0.000
active ulcerative colitis 1.572 0.014
ovarian cancer -2.400 0.000

Synonym

Accession P12644 Q9UM80 BMP-4
Symbols ZYME
BMP2B
OFC11
BMP2B1
MCOPS6

Gene

PANTHER Protein Class (2)

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
652282 confirmatory 16 / 0 / 1 Discovery and structure-activity relationship of BMP Inhibitors
652288 summary 0 / 0 / 0 Developing potent and selective BMP inhibitors as translational tools to develop future therapies

Gene RIF (279)

PMID Text
26970275 BMP4 caused a trend towards accelerated metastasis formation, especially in bone. More work is needed to uncover the long-term effects of BMP4 and the clinical relevance of these findings.
26769046 PDGF-AA impairs endothelium-dependent vasodilation and PDGF-AA mediates BMP4-induced adverse effect on endothelial cell function through SMAD1/5- and SMAD4-dependent mechanisms.
26684238 we have for the first time characterized the BMP4-induced miRNA expression profiles in breast cancer cell lines, showing that induced miRNAs contribute to the fine-tuning of proliferation and migration phenotypes.
26676745 BMP4 is a direct thyroid hormone target and is involved in a positive autoregulatory feedback loop that modulates thyroid hormone signaling
26426615 Serum levels independently associated with coronary artery disease severity in males
26406943 An up-regulated expression of BMP-4 and BMPR-II was observed in the peripheral blood of breast cancer patients especially in the advanced-stage of the disease. Moreover, BMP-4 and BMPR-II expressions were found to be correlated
26386860 Suggest that hypermethylation of ACP1, BMP4, and TSPYL5 are common events in HCC and could be used as potentially detectable biomarkers in HCC tissues.
26339396 Overexpression of the BMP4/SMAD4/SMAD5 signaling pathway could predict poor clinical outcome in skull base chordomas, suggesting activation of this pathway is involved in chordoma pathogenesis.
26304754 BMP4, BMP7 and receptors are expressed and active in the human fetal leptomeninges.
26215597 BMP4 gene is involved in the ATO regulation of adipogenic and osteogenic differentiation balance, which provides a new target for the treatment of AA
More...

AA Sequence

MIPGNRMLMVVLLCQVLLGGASHASLIPETGKKKVAEIQGHAGGRRSGQSHELLRDFEATLLQMFGLRRR      1 - 70
PQPSKSAVIPDYMRDLYRLQSGEEEEEQIHSTGLEYPERPASRANTVRSFHHEEHLENIPGTSENSAFRF     71 - 140
LFNLSSIPENEVISSAELRLFREQVDQGPDWERGFHRINIYEVMKPPAEVVPGHLITRLLDTRLVHHNVT    141 - 210
RWETFDVSPAVLRWTREKQPNYGLAIEVTHLHQTRTHQGQHVRISRSLPQGSGNWAQLRPLLVTFGHDGR    211 - 280
GHALTRRRRAKRSPKHHSQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLN    281 - 350
STNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR                351 - 408
//

Text Mined References (345)

PMID Year Title
26970275 2016 The impact of bone morphogenetic protein 4 (BMP4) on breast cancer metastasis in a mouse xenograft model.
26769046 2016 Bone Morphogenic Protein 4-Smad-Induced Upregulation of Platelet-Derived Growth Factor AA Impairs Endothelial Function.
26684238 2016 Bone morphogenetic protein 4 regulates microRNA expression in breast cancer cell lines in diverse fashion.
26676745 2016 Activated Thyroid Hormone Promotes Differentiation and Chemotherapeutic Sensitization of Colorectal Cancer Stem Cells by Regulating Wnt and BMP4 Signaling.
26426615 2015 Serum Bone Morphogenic Protein-4 Contributes to Discriminating Coronary Artery Disease Severity.
26406943 2015 Transcriptional up-regulation of BMP-4 and BMPR-II genes in the peripheral blood of breast cancer patients: A pilot study.
26386860 2016 Hypermethylation of ACP1, BMP4, and TSPYL5 in Hepatocellular Carcinoma and Their Potential Clinical Significance.
26339396 2015 Overexpression of the BMP4/SMAD signaling pathway in skull base chordomas is associated with poor prognosis.
26304754 2015 Bone morphogenetic protein-4 and 7 and receptors regulate vascular endothelial growth factor and receptors in human fetal leptomeninges.
26215597 2015 Arsenic trioxide regulates adipogenic and osteogenic differentiation in bone marrow MSCs of aplastic anemia patients through BMP4 gene.
More...