Property Summary

NCBI Gene PubMed Count 502
Grant Count 1,057
R01 Count 669
Funding $109,229,038.03
PubMed Score 4267.50
PubTator Score 2601.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
malignant mesothelioma -8.300 0.000
astrocytic glioma 2.600 0.002
ependymoma 2.600 0.004
oligodendroglioma 3.600 0.002
esophageal adenocarcinoma 1.300 0.018
cutaneous lupus erythematosus -1.400 0.006
psoriasis -1.600 0.001
glioblastoma 1.200 0.041
osteosarcoma 2.013 0.010
Atopic dermatitis -1.300 0.000
non-small cell lung cancer -2.204 0.000
intraductal papillary-mucinous neoplasm ... 2.000 0.030
colon cancer -2.900 0.000
lung cancer -3.700 0.000
active Crohn's disease -1.194 0.014
interstitial cystitis -2.700 0.001
pediatric high grade glioma 1.500 0.004
group 4 medulloblastoma -1.500 0.001
pilocytic astrocytoma 2.000 0.000
lung adenocarcinoma -1.482 0.001
nasopharyngeal carcinoma 1.200 0.013
lung carcinoma -1.300 0.000
spina bifida -1.068 0.040
ductal carcinoma in situ -2.500 0.000
invasive ductal carcinoma -2.700 0.003
ovarian cancer -3.300 0.000

Synonym

Accession P12643 BMP-2
Symbols BDA2
BMP2A

Gene

PANTHER Protein Class (2)

PDB

2H62   4N1D   1ES7   1REU   1REW   2GOO   2H64   2QJ9   2QJA   2QJB   3BK3   3BMP   4MID   4UHY   4UHZ   4UI0   4UI1   4UI2  

 GWAS Trait (1)

Gene RIF (432)

PMID Text
26845276 detected a joint effect of SNP and G x E interaction in BMP2 and CACNA2D1 for depressive state.
26808122 combination of adenoviral mediated BMP-2 expression in BMSC grown in the newly developed poly(LLA-co-CL) scaffolds induced expression of osteogenic markers and enhanced bone formation in vivo
26636769 The findings in this study provide new insights into the regulatory mechanism of BMP-2 induction in leptin-stimulated chondrocytes and suggest that BMP-2 may play a reparative role in regulating leptin-induced OA development.
26621735 results explain why BMP2 suppresses growth in vitro and promotes growth in vivo. Together, our results support BMP2 as a therapeutic target in ovarian cancer
26563344 ata show that dedifferentiated chondrocytes can be redifferentiated following treatment with the chimeric erythroid differentiation factor (activin A)/bone morphogenetic protein 2 (BMP2) ligand AB235.
26494778 BMP-2 has dual activity, inducing osteogenic and adipogenic differentiation, subject to hASC donor line studied
26491693 These results suggest that a combination of d-BCP and rhBMP2 can accelerate bone regeneration, and this could be used to develop therapeutic strategies in hard tissue healing.
26466853 Heterodimeric BMP-2/7 significantly promoted osteogenesis of human adipose-derived stem cells in vitro and in vivo. However, BMP-2/7 was not found to be a stronger inducer of osteogenesis compared to homodimeric either BMP-2 or BMP-7.
26460254 study analyzed BMP2 gene in non-HFE haemochromatosis patients; taken together we postulate that BMP2 rs235768 is a new susceptibility factor for haemochromatosis; it can contribute to iron overload in association with other genetic and environmental factors
26413886 An imbalance between BMP-2 and Noggin secretion induces abnormal osteogenic differentiation of ankylosing spondylitis-mesenchymal stem cells.
More...

AA Sequence

MVAGTRCLLALLLPQVLLGGAAGLVPELGRRKFAAASSGRPSSQPSDEVLSEFELRLLSMFGLKQRPTPS      1 - 70
RDAVVPPYMLDLYRRHSGQPGSPAPDHRLERAASRANTVRSFHHEESLEELPETSGKTTRRFFFNLSSIP     71 - 140
TEEFITSAELQVFREQMQDALGNNSSFHHRINIYEIIKPATANSKFPVTRLLDTRLVNQNASRWESFDVT    141 - 210
PAVMRWTAQGHANHGFVVEVAHLEEKQGVSKRHVRISRSLHQDEHSWSQIRPLLVTFGHDGKGHPLHKRE    211 - 280
KRQAKHKQRKRLKSSCKRHPLYVDFSDVGWNDWIVAPPGYHAFYCHGECPFPLADHLNSTNHAIVQTLVN    281 - 350
SVNSKIPKACCVPTELSAISMLYLDENEKVVLKNYQDMVVEGCGCR                            351 - 396
//

Text Mined References (504)

PMID Year Title
26845276 2016 Genome-wide environment interaction between depressive state and stressful life events.
26808122 2016 Adenoviral Mediated Expression of BMP2 by Bone Marrow Stromal Cells Cultured in 3D Copolymer Scaffolds Enhances Bone Formation.
26636769 2015 Upregulation of Bone Morphogenetic Protein-2 Synthesis and Consequent Collagen II Expression in Leptin-stimulated Human Chondrocytes.
26621735 2015 Identifying an ovarian cancer cell hierarchy regulated by bone morphogenetic protein 2.
26563344 2015 Activin A/BMP2 chimera AB235 drives efficient redifferentiation of long term cultured autologous chondrocytes.
26494778 2015 Bone Morphogenetic Protein-2 Induces Donor-Dependent Osteogenic and Adipogenic Differentiation in Human Adipose Stem Cells.
26491693 2015 Repair of Cranial Bone Defects Using rhBMP2 and Submicron Particle of Biphasic Calcium Phosphate Ceramics with Through-Hole.
26466853 2015 Effects of heterodimeric bone morphogenetic protein-2/7 on osteogenesis of human adipose-derived stem cells.
26460254 2015 A coding polymorphism in the BMP2 gene is associated with iron overload in non-HFE haemochromatosis patients.
26413886 2016 Imbalance Between Bone Morphogenetic Protein 2 and Noggin Induces Abnormal Osteogenic Differentiation of Mesenchymal Stem Cells in Ankylosing Spondylitis.
More...