Property Summary

NCBI Gene PubMed Count 58
PubMed Score 298.04
PubTator Score 170.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
psoriasis 6685 9.30799975389377E-66
lung carcinoma 2844 3.50271050581777E-8
lung cancer 4473 8.26710436607541E-7
tuberculosis 1563 1.66853263560057E-6
cutaneous lupus erythematosus 1056 6.54475810200372E-5
primary Sjogren syndrome 789 1.88363113543146E-4
lung adenocarcinoma 2714 5.9223525177311E-4
ovarian cancer 8492 9.02114865510147E-4
interstitial cystitis 2299 0.00205618257351036
invasive ductal carcinoma 2950 0.00340535371103041
nasopharyngeal carcinoma 1056 0.00860388351739108
nephrosclerosis 329 0.0163011839945739
adult high grade glioma 2148 0.0186683134590151
sarcoidosis 368 0.0209872239267373
head and neck cancer and chronic obstructive pulmonary disease 237 0.0355367088379174
glioblastoma 5572 0.039210484431754
chronic kidney disease 90 0.0482355934411942
Disease Target Count Z-score Confidence
Cancer 2346 3.07 1.5

Expression

  Differential Expression (17)

Disease log2 FC p
nephrosclerosis 1.094 0.016
cutaneous lupus erythematosus 3.200 0.000
psoriasis 1.700 0.000
glioblastoma 1.100 0.039
chronic kidney disease 1.500 0.048
tuberculosis 2.400 0.000
lung cancer -3.100 0.000
sarcoidosis 1.800 0.021
interstitial cystitis 2.100 0.002
adult high grade glioma 1.300 0.019
primary Sjogren syndrome 2.400 0.000
invasive ductal carcinoma 1.311 0.003
nasopharyngeal carcinoma 1.300 0.009
lung adenocarcinoma -1.266 0.001
lung carcinoma -1.100 0.000
ovarian cancer -1.800 0.001
head and neck cancer and chronic obstruc... 1.300 0.036

Synonym

Accession P12544 A4PHN1 Q6IB36
Symbols HFSP
CTLA3

Gene

PDB

1HF1   1OP8   1ORF  

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG
Opossum OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (37)

PMID Text
26752517 Delivered into parasite infected cells by granulysin and perforin, granzymes generate superoxide and inactivate oxidative defense enzymes to kill the parasite.
26522261 Levels of GZMA and ITGAE mRNAs in colon tissues can identify patients with UC who are most likely to benefit from etrolizumab; expression levels decrease with etrolizumab administration in biomarker(high) patients.
26156785 Results reveal enhanced intra- and extracellular expression of gzmA and B in patients with pulmonary TB, suggesting that gzms are part of the host response to tuberculosis.
26051682 Our results suggest that granzyme A could be considered another biomarker of TB, that can be used, other than IFN-gamma, to discriminate between patients with active TB and LTBI subjects
26032366 Taken together, the authors verified that histone H3 is a real substrate for GzmA in vivo in the Raji cells treated by staurosporin.
26025597 GZMA, GBP5 and CD64 genes show promise as a rapid diagnostic markers separating tuberculosis from other pulmonary diseases.
25928296 We herewith identify GZMA as critical effector molecule of human Treg function for gastrointestinal immune response in an experimental GvHD model.
25745046 GzmA and GzmB expressing cells in the airways and lung parenchyma was higher in subjects who died from asthma
25437548 The exocytosed granzyme A enters target cells and mediates IL-1beta maturation independently of caspase-1 and without inducing cytotoxicity.
25383893 Data indicate N-terminomics on the human and mouse granzymes A and K by combined fractional diagonal chromatography (COFRADIC).
More...

AA Sequence

MRNSYRFLASSLSVVVSLLLIPEDVCEKIIGGNEVTPHSRPYMVLLSLDRKTICAGALIAKDWVLTAAHC      1 - 70
NLNKRSQVILGAHSITREEPTKQIMLVKKEFPYPCYDPATREGDLKLLQLMEKAKINKYVTILHLPKKGD     71 - 140
DVKPGTMCQVAGWGRTHNSASWSDTLREVNITIIDRKVCNDRNHYNFNPVIGMNMVCAGSLRGGRDSCNG    141 - 210
DSGSPLLCEGVFRGVTSFGLENKCGDPRGPGVYILLSKKHLNWIIMTIKGAV                      211 - 262
//

Text Mined References (62)

PMID Year Title
26752517 2016 Killer lymphocytes use granulysin, perforin and granzymes to kill intracellular parasites.
26522261 2016 Association Between Response to Etrolizumab and Expression of Integrin ?E and Granzyme A in Colon Biopsies of Patients With Ulcerative Colitis.
26156785 2015 Increased intra- and extracellular granzyme expression in patients with tuberculosis.
26051682 2015 Granzyme A as a potential biomarker of Mycobacterium tuberculosis infection and disease.
26032366 2015 Histone H3 is Digested by Granzyme A During Compromised Cell Death in the Raji Cells.
26025597 2015 A real-time PCR signature to discriminate between tuberculosis and other pulmonary diseases.
25928296 2015 Granzyme A Is Required for Regulatory T-Cell Mediated Prevention of Gastrointestinal Graft-versus-Host Disease.
25745046 2015 Increased expression of granzymes A and B in fatal asthma.
25437548 2014 Granzyme A produces bioactive IL-1? through a nonapoptotic inflammasome-independent pathway.
25383893 2014 Substrate specificities of the granzyme tryptases A and K.
More...