Property Summary

NCBI Gene PubMed Count 61
PubMed Score 315.23
PubTator Score 170.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
tuberculosis 2.400 1.7e-06
adult high grade glioma 1.300 1.9e-02
chronic kidney disease 1.500 4.8e-02
cutaneous lupus erythematosus 3.200 6.5e-05
glioblastoma 1.100 3.9e-02
head and neck cancer and chronic obstruc... 1.300 3.6e-02
interstitial cystitis 2.100 2.1e-03
invasive ductal carcinoma 1.311 3.4e-03
lung adenocarcinoma -1.266 5.9e-04
lung cancer -1.900 2.2e-03
lung carcinoma -1.100 3.5e-08
nasopharyngeal carcinoma 1.300 8.6e-03
nephrosclerosis 1.094 1.6e-02
ovarian cancer -1.800 9.0e-04
primary Sjogren syndrome 2.400 1.9e-04
psoriasis 1.400 5.2e-03
sarcoidosis 1.800 2.1e-02

Gene RIF (40)

AA Sequence

MRNSYRFLASSLSVVVSLLLIPEDVCEKIIGGNEVTPHSRPYMVLLSLDRKTICAGALIAKDWVLTAAHC      1 - 70
NLNKRSQVILGAHSITREEPTKQIMLVKKEFPYPCYDPATREGDLKLLQLMEKAKINKYVTILHLPKKGD     71 - 140
DVKPGTMCQVAGWGRTHNSASWSDTLREVNITIIDRKVCNDRNHYNFNPVIGMNMVCAGSLRGGRDSCNG    141 - 210
DSGSPLLCEGVFRGVTSFGLENKCGDPRGPGVYILLSKKHLNWIIMTIKGAV                      211 - 262
//

Text Mined References (65)

PMID Year Title