Property Summary

NCBI Gene PubMed Count 26
Grant Count 5
R01 Count 3
Funding $492,558
PubMed Score 78.62
PubTator Score 6.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.300 0.000

Synonym

Accession P12532 B4DIT8 B7ZA09 Q0VAM3 Q32NF6 Q53FC4
Symbols CKMT1
U-MtCK
mia-CK

Gene

PANTHER Protein Class (3)

PDB

1QK1  

Gene RIF (7)

PMID Text
24522192 CKMT1 is a key regulator of the permeability transition pore through a complex that is distinct from the classical permeability transition pore.
23880370 the knock-down of the mitochondrial creatine kinase-1 (CKMT1) by RNA interference causes the dissipation of the mitochondrial membrane potential
22190034 HIV-1 IN is identified to have a physical interaction with creatine kinase, mitochondrial 1A (CKMT1A) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
20877624 Observational study of gene-disease association. (HuGE Navigator)
20302626 ASB9 interacts with the creatine kinase system and negatively regulates cell growth.
19415690 uMtCK in prostate neoplasm cells (LNCaP) contributes to overproduction of reactive oxygen species, activation of Akt signaling pathway and more aggressive phenotypes including androgen independence development.
17028143 MtCK, but not NDPK-D, shows some specificity in the nature of the lipids transferred and it is not active with phosphatidylcholine alone

AA Sequence

MAGPFSRLLSARPGLRLLALAGAGSLAAGFLLRPEPVRAASERRRLYPPSAEYPDLRKHNNCMASHLTPA      1 - 70
VYARLCDKTTPTGWTLDQCIQTGVDNPGHPFIKTVGMVAGDEETYEVFADLFDPVIQERHNGYDPRTMKH     71 - 140
TTDLDASKIRSGYFDERYVLSSRVRTGRSIRGLSLPPACTRAERREVERVVVDALSGLKGDLAGRYYRLS    141 - 210
EMTEAEQQQLIDDHFLFDKPVSPLLTAAGMARDWPDARGIWHNNEKSFLIWVNEEDHTRVISMEKGGNMK    211 - 280
RVFERFCRGLKEVERLIQERGWEFMWNERLGYILTCPSNLGTGLRAGVHIKLPLLSKDSRFPKILENLRL    281 - 350
QKRGTGGVDTAATGGVFDISNLDRLGKSEVELVQLVIDGVNYLIDCERRLERGQDIRIPTPVIHTKH       351 - 417
//

Text Mined References (28)

PMID Year Title
24522192 2014 CKMT1 regulates the mitochondrial permeability transition pore in a process that provides evidence for alternative forms of the complex.
23880370 2013 Reconstitution of CKMT1 expression fails to rescue cells from mitochondrial membrane potential dissipation: implications for controlling RNAi experiments.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20302626 2010 ASB9 interacts with ubiquitous mitochondrial creatine kinase and inhibits mitochondrial function.
19415690 2009 Ubiquitous mitochondrial creatine kinase is overexpressed in the conditioned medium and the extract of LNCaP lineaged androgen independent cell lines and facilitates prostate cancer progression.
17028143 2007 Novel lipid transfer property of two mitochondrial proteins that bridge the inner and outer membranes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...