Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.00
PubTator Score 2.50

Knowledge Summary

Patent

No data available

AA Sequence

MDRDSYHHYFYDYDGGEDFYRSTTPSEDIWKKFELVPPPWDLGPAAGNPALSFGLLEPWPVGCAGDETES      1 - 70
QDYWKAWDANYASLIRRDCMWSGFSTQEPLERAVSDLLAVGAPSGYSPKEFATPDYTPELEAGNLAPIFP     71 - 140
CLLGEPKIQACSRSESPSDSEGEEIDVTVKKRQSLSTRKPVIIAVRADLLDPRMNLFHISIHQQQHNYAA    141 - 210
PFPPESCFQEGAPKRMPPKEALEREAPGGKDDKEDEEIVSLPPVESEAAQSCQPKPIHYDTENWTKKKYH    211 - 280
SYLERKRRNDQRSRFLALRDEVPALASCSRVSKVMILVKATEYLHELAEAEERMATEKRQLECQRRQLQK    281 - 350
RIEYLSSY                                                                  351 - 358
//

Text Mined References (9)

PMID Year Title