Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.00
PubTator Score 2.50

Knowledge Summary

Patent

No data available

Synonym

Accession P12525 O43372
Symbols MYCL2
L-MYC2
MYCL1P1
bHLHe38

Gene

 GO Component (1)

 Compartment GO Term (0)

AA Sequence

MDRDSYHHYFYDYDGGEDFYRSTTPSEDIWKKFELVPPPWDLGPAAGNPALSFGLLEPWPVGCAGDETES      1 - 70
QDYWKAWDANYASLIRRDCMWSGFSTQEPLERAVSDLLAVGAPSGYSPKEFATPDYTPELEAGNLAPIFP     71 - 140
CLLGEPKIQACSRSESPSDSEGEEIDVTVKKRQSLSTRKPVIIAVRADLLDPRMNLFHISIHQQQHNYAA    141 - 210
PFPPESCFQEGAPKRMPPKEALEREAPGGKDDKEDEEIVSLPPVESEAAQSCQPKPIHYDTENWTKKKYH    211 - 280
SYLERKRRNDQRSRFLALRDEVPALASCSRVSKVMILVKATEYLHELAEAEERMATEKRQLECQRRQLQK    281 - 350
RIEYLSSY                                                                  351 - 358
//

Text Mined References (9)

PMID Year Title
15772651 2005 The DNA sequence of the human X chromosome.
12093377 2002 Phylogenetic analysis of the human basic helix-loop-helix proteins.
10229200 1999 Differential effects of the widely expressed dMax splice variant of Max on E-box vs initiator element-mediated regulation by c-Myc.
10100857 1999 Mapping of the MYCL2 processed gene to Xq22-23 and identification of an additional L MYC-related sequence in Xq27.2.
7479755 1995 Myc and Max: molecular evolution of a family of proto-oncogene products and their dimerization partner.
3054516 1988 The human L-myc gene encodes multiple nuclear phosphoproteins from alternatively processed mRNAs.
2827002 1988 Structure and expression of the human L-myc gene reveal a complex pattern of alternative mRNA processing.
2541066 1989 Mapping and characterization of an X-linked processed gene related to MYCL1.
1711681 1991 Testis-specific expression of the human MYCL2 gene.