Property Summary

NCBI Gene PubMed Count 37
Grant Count 50
R01 Count 38
Funding $3,231,093.02
PubMed Score 403.77
PubTator Score 182.82

Knowledge Summary

Patent

No data available

Expression

Gene RIF (27)

PMID Text
25528583 These results suggest that Mycl1 expression might be useful as a biomarker to predict prognosis and is a promising therapeutic target for patients with gastric cancer.
23349019 Several tagging SNPs and haplotypes in TRIT1, MYCL1 and MFSD2A region are significantly associated with risk and clinicopathological features of gastric cancer in a Chinese population.
22490849 The polymorphism of H-ras and L-myc genes is not related to colorectal cancer risk, but there is a synergy between H-ras and L-myc polymorphisms in the development of rectal cancer.
21676885 MYCL1 is the target of hsa-miR-1827. A rs3134615 G>T SNP in the 3'-UTR altered regulation of MYCL1 expression. This SNP was associated with increased susceptibility to SCLC, possibly resulting from attenuated interaction with the miRNA hsa-miR-1827.
20874233 The results demonstrate that MYCL1 rs3134613 is associated with susceptibility to diffuse-type gastric cancer and with differentiation of gastric cancer.
20095854 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19536170 Meta-analysis of gene-disease association. (HuGE Navigator)
19020549 L-Myc may have a role in Merkel cell carcinoma pathogenesis
18645122 The L-myc gene polymorphism may help detect and prevent HNNMSC and LLC in susceptible individuals. It may also contribute to estimation of tumor behavior in patients with HNNMSC.
18645122 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MDYDSYQHYFYDYDCGEDFYRSTAPSEDIWKKFELVPSPPTSPPWGLGPGAGDPAPGIGPPEPWPGGCTG      1 - 70
DEAESRGHSKGWGRNYASIIRRDCMWSGFSARERLERAVSDRLAPGAPRGNPPKASAAPDCTPSLEAGNP     71 - 140
APAAPCPLGEPKTQACSGSESPSDSENEEIDVVTVEKRQSLGIRKPVTITVRADPLDPCMKHFHISIHQQ    141 - 210
QHNYAARFPPESCSQEEASERGPQEEVLERDAAGEKEDEEDEEIVSPPPVESEAAQSCHPKPVSSDTEDV    211 - 280
TKRKNHNFLERKRRNDLRSRFLALRDQVPTLASCSKAPKVVILSKALEYLQALVGAEKRMATEKRQLRCR    281 - 350
QQQLQKRIAYLTGY                                                            351 - 364
//

Text Mined References (38)

PMID Year Title
25528583 2015 Expression and prognostic value of Mycl1 in gastric cancer.
23349019 2013 Association of polymorphisms and haplotype in the region of TRIT1, MYCL1 and MFSD2A with the risk and clinicopathological features of gastric cancer in a southeast Chinese population.
22490849 2012 [Association between H-ras and L-myc gene polymorphisms and susceptibility to colorectal cancer].
21676885 2011 Genetic variation in an miRNA-1827 binding site in MYCL1 alters susceptibility to small-cell lung cancer.
20874233 2010 Association of a MYCL1 single nucleotide polymorphism, rs3134613, with susceptibility to diffuse-type gastric cancer and with differentiation of gastric cancer in a southeast Chinese population.
20095854 2010 Novel breast cancer risk alleles and interaction with ionizing radiation among U.S. radiologic technologists.
19536170 2009 Cell proliferation-related genetic polymorphisms and gastric cancer risk: systematic review and meta-analysis.
19020549 2009 Array-CGH reveals recurrent genomic changes in Merkel cell carcinoma including amplification of L-Myc.
18645122 2008 L-myc polymorphism in head and neck nonmelanoma skin and lower lip cancers.
18566574 2008 L-myc gene polymorphism and risk of thyroid cancer.
More...