Property Summary

NCBI Gene PubMed Count 37
PubMed Score 450.67
PubTator Score 182.82

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
medulloblastoma 1.500 1.2e-03
atypical teratoid / rhabdoid tumor 2.100 7.5e-04
cutaneous lupus erythematosus -1.200 2.8e-03
ductal carcinoma in situ 1.300 6.2e-04
esophageal adenocarcinoma -1.400 3.4e-02
interstitial cystitis -2.500 4.9e-03
intraductal papillary-mucinous adenoma (... -1.400 1.1e-02
intraductal papillary-mucinous neoplasm ... -1.700 1.8e-02
lung cancer 1.200 9.6e-03
non-small cell lung cancer 1.236 5.1e-07
ovarian cancer 1.700 3.7e-05
pancreatic cancer -1.100 2.5e-03
psoriasis -1.100 1.5e-04
tuberculosis 2.000 1.3e-04

 GWAS Trait (1)

Gene RIF (27)

AA Sequence

MDYDSYQHYFYDYDCGEDFYRSTAPSEDIWKKFELVPSPPTSPPWGLGPGAGDPAPGIGPPEPWPGGCTG      1 - 70
DEAESRGHSKGWGRNYASIIRRDCMWSGFSARERLERAVSDRLAPGAPRGNPPKASAAPDCTPSLEAGNP     71 - 140
APAAPCPLGEPKTQACSGSESPSDSENEEIDVVTVEKRQSLGIRKPVTITVRADPLDPCMKHFHISIHQQ    141 - 210
QHNYAARFPPESCSQEEASERGPQEEVLERDAAGEKEDEEDEEIVSPPPVESEAAQSCHPKPVSSDTEDV    211 - 280
TKRKNHNFLERKRRNDLRSRFLALRDQVPTLASCSKAPKVVILSKALEYLQALVGAEKRMATEKRQLRCR    281 - 350
QQQLQKRIAYLTGY                                                            351 - 364
//

Text Mined References (38)

PMID Year Title