Property Summary

NCBI Gene PubMed Count 125
Grant Count 18
R01 Count 5
Funding $2,309,675.33
PubMed Score 208.20
PubTator Score 640.35

Knowledge Summary

Patent

No data available

Expression

Gene RIF (110)

PMID Text
26774660 IgG2 and IgG3 are involved in recruiting CD32 to inhibit activation of FcepsilonRI in human basophils.
26707911 F-AFE containing anti-allergic phytochemicals, including arctigenin, inhibited the activation of the FceRI receptor induced by the antigenIgE complex
26626992 Asthmatics with reduced lung function had a higher frequency of Lin(-) CD34(hi) CD117(int/hi) Fc epsilon RI(+) blood mast cell progenitors than asthmatics with normal lung function.
26136426 Tetraspanin CD151 Is a Negative Regulator of FcepsilonRI-Mediated Mast Cell Activation
25923080 SNPs of FcepsilonR1alpha promoter region may be used as disease markers for IgE-mediated allergic inflammation caused by Dermatophagoides pteronyssinus.
25713122 FcepsilonRI alpha-chain is an activating platelet endothelium aggregation receptor 1 (PEAR1) ligand.
25412950 These data suggest that rs2298805 might be associated with risk for Chronic urticaria and the therapeutic efficacy of nonsedating H1-antihistamines in Chinese patients
24610015 Data indicate that antigen (Ag) targeting to FcepsilonRI inhibits the development of Ag-specific T cell immunity and induces T cell tolerance.
24569373 FCER1A expressing dendritic cells and monocytes but not basophils, significantly contribute to serum hIgE clearance.
24361879 Overexpression of miR-142-3p enhances FcepsilonRI-mediated degranulation.
More...

AA Sequence

MAPAMESPTLLCVALLFFAPDGVLAVPQKPKVSLNPPWNRIFKGENVTLTCNGNNFFEVSSTKWFHNGSL      1 - 70
SEETNSSLNIVNAKFEDSGEYKCQHQQVNESEPVYLEVFSDWLLLQASAEVVMEGQPLFLRCHGWRNWDV     71 - 140
YKVIYYKDGEALKYWYENHNISITNATVEDSGTYYCTGKVWQLDYESEPLNITVIKAPREKYWLQFFIPL    141 - 210
LVVILFAVDTGLFISTQQQVTFLLKIKRTRKGFRLLNPHPKPNPKNN                           211 - 257
//

Text Mined References (126)

PMID Year Title
26774660 2016 Parameters determining the efficacy of CD32 to inhibit activation of Fc?RI in human basophils.
26707911 2016 Inhibitory effect of fermented Arctium lappa fruit extract on the IgE-mediated allergic response in RBL?2H3 cells.
26626992 2016 Lin- CD34hi CD117int/hi Fc?RI+ cells in human blood constitute a rare population of mast cell progenitors.
26136426 2015 Tetraspanin CD151 Is a Negative Regulator of Fc?RI-Mediated Mast Cell Activation.
25923080 2015 An Exploratory Pilot Study of Genetic Marker for IgE-Mediated Allergic Diseases with Expressions of Fc?R1? and C?.
25713122 2015 A Human Platelet Receptor Protein Microarray Identifies the High Affinity Immunoglobulin E Receptor Subunit ? (Fc?R1?) as an Activating Platelet Endothelium Aggregation Receptor 1 (PEAR1) Ligand.
25412950 2015 Association of FCER1A genetic polymorphisms with risk for chronic spontaneous urticaria and efficacy of nonsedating H1-antihistamines in Chinese patients.
24610015 2014 Antigen-conjugated human IgE induces antigen-specific T cell tolerance in a humanized mouse model.
24569373 2014 Serum IgE clearance is facilitated by human Fc?RI internalization.
24361879 2014 miR-142-3p enhances Fc?RI-mediated degranulation in mast cells.
More...