Property Summary

NCBI Gene PubMed Count 416
Grant Count 276
R01 Count 161
Funding $40,928,243.8
PubMed Score 774.96
PubTator Score 588.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
inflammatory breast cancer 1.100 0.018
lung carcinoma -3.200 0.000
mucosa-associated lymphoid tissue lympho... 2.254 0.017

Synonym

Accession P12318 Q8WUN1 Q8WW64 IgG Fc receptor II-a
Symbols CD32
FCG2
FcGR
CD32A
CDw32
FCGR2
IGFR2
FCGR2A1

Gene

PANTHER Protein Class (1)

PDB

3D5O   3RY6   1FCG   1H9V   3RY4   3RY5  

Gene RIF (443)

PMID Text
26774660 IgG2 and IgG3 are involved in recruiting CD32 to inhibit activation of FcepsilonRI in human basophils.
26748351 Fc-gamma receptor polymorphisms differentially influence susceptibility to systemic lupus erythematosus and lupus nephritis.
26510856 FCGR3A and FCGR2A SNPs do not confer differential responsiveness to rituximab.
26496101 Genetic variation Fc gamma receptor IIA may contribute to infectious susceptibility in trauma patients.
26450443 FcgammaRIIIA/FcgammaRIIA gene polymorphisms and HER-2 may have a role in antibody-dependent cellular cytotoxicity and clinical response to trastuzumab in breast cancer
26429312 FCGR2A polymorphisms constitute a risk factor for graft loss following kidney transplantation and that this effect is related to anti-HLA antibodies.
26429310 The results show an association between FcgRIIa, TNF-alpha and IL-6 gene single nucleotide polymorphisms and symptom persistence in Dengue patients.
26429304 R/R genotype of FCGR2A p.R131H and G/G genotype of CCL2 c.-2518 A > G polymorphisms are associated with thrombocytopenia, which is a characteristic laboratory finding in dengue infections.
26427148 The genetic mutation FcgammaRIIa is a predisposing factor for manifestation of heparin-induced thrombocytopenia, but the process of seroconversion apparently needs another inducing factor.
26396093 CD32a antibodies induce thrombocytopenia and type II hypersensitivity reactions in FCGR2A
More...

AA Sequence

MTMETQMSQNVCPRNLWLLQPLTVLLLLASADSQAAAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPES      1 - 70
DSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIM     71 - 140
LRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQVPSM    141 - 210
GSSSPMGIIVAVVIATAVAAIVAAVVALIYCRKKRISANSTDPVKAAQFEPPGRQMIAIRKRQLEETNND    211 - 280
YETADGGYMTLNPRAPTDDDKNIYLTLPPNDHVNSNN                                     281 - 317
//

Text Mined References (422)

PMID Year Title
26774660 2016 Parameters determining the efficacy of CD32 to inhibit activation of Fc?RI in human basophils.
26748351 2016 Fc-gamma receptor polymorphisms differentially influence susceptibility to systemic lupus erythematosus and lupus nephritis.
26510856 2016 Fc Gamma Receptor 3A and 2A Polymorphisms Do Not Predict Response to Rituximab in Follicular Lymphoma.
26496101 2015 An Fc?RIIa polymorphism with decreased C-reactive protein binding is associated with sepsis and decreased monocyte HLA-DR expression in trauma patients.
26450443 2015 Analysis of in vitro ADCC and clinical response to trastuzumab: possible relevance of Fc?RIIIA/Fc?RIIA gene polymorphisms and HER-2 expression levels on breast cancer cell lines.
26429312 2015 Association of a coding polymorphism in Fc gamma receptor 2A and graft survival in re-transplant candidates.
26429310 2015 Single nucleotide polymorphisms in immune system genes and their association with clinical symptoms persistence in dengue-infected persons.
26429304 2015 Association of FCGR2A p.R131H and CCL2 c.-2518 A>G gene variants with thrombocytopenia in patients with dengue virus infection.
26427148 2015 Polymorphism of the Fc? Receptor II as a Possible Predisposing Factor for Heparin-Induced Thrombocytopenia.
26396093 2015 CD32a antibodies induce thrombocytopenia and type II hypersensitivity reactions in FCGR2A mice.
More...