Property Summary

NCBI Gene PubMed Count 119
Grant Count 128
R01 Count 73
Funding $15,056,316.78
PubMed Score 1006.30
PubTator Score 1075.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 2.500 0.000

Synonym

Accession P12314 P12315 Q5QNW7 Q92495 Q92663 IgG Fc receptor I
Symbols CD64
FCRI
CD64A
IGFR1

Gene

PANTHER Protein Class (1)

PDB

4W4O   4X4M   4ZNE   3RJD  

Gene RIF (91)

PMID Text
26527150 The three-dimensional structure of a human IgG1 Fc fragment bound to wild-type human Fc-gamma RI is reported
26406605 Early RA patients display increased membrane and soluble CD64 and an impaired FcgammaR function correlating with joint disease activity.
26322411 Monocyte HLA-DR and neutrophil CD64 expression in critically ill infants with sepsis are related to age and infection.
26153451 The results indicate that conformational plasticity, as well as the openness of the upper CH2 region, is critical for FcgammaR binding and therapeutic effector functions of IgG antibodies.
26147145 neutrophil CD64 expression tends to be low in the healthy state and increases in patients with advanced cancer even in the absence of active infection
26025597 GZMA, GBP5 and CD64 genes show promise as a rapid diagnostic markers separating tuberculosis from other pulmonary diseases.
25925696 hydrophobic pocket at the surface perfectly suited for residue Leu235 of Fc
25854904 CD64 index, CRP and sCD14-ST served as good parameters to determine possible infection in patients that needed intensive care after major procedures.
25802446 we address of monocytes functional status through assessment of the patterns of expression of Fcgamma receptors CD64, CD32, CD16 and CD180 receptor on monocytes from CLL patients and healthy individuals using specific mAbs and flow cytometry.
25566870 FcgammaRI levels were found to not be associated with vascular leakage in dengue patients.
More...

AA Sequence

MWFLTTLLLWVPVDGQVDTTKAVITLQPPWVSVFQEETVTLHCEVLHLPGSSSTQWFLNGTATQTSTPSY      1 - 70
RITSASVNDSGEYRCQRGLSGRSDPIQLEIHRGWLLLQVSSRVFTEGEPLALRCHAWKDKLVYNVLYYRN     71 - 140
GKAFKFFHWNSNLTILKTNISHNGTYHCSGMGKHRYTSAGISVTVKELFPAPVLNASVTSPLLEGNLVTL    141 - 210
SCETKLLLQRPGLQLYFSFYMGSKTLRGRNTSSEYQILTARREDSGLYWCEAATEDGNVLKRSPELELQV    211 - 280
LGLQLPTPVWFHVLFYLAVGIMFLVNTVLWVTIRKELKRKKKWDLEISLDSGHEKKVISSLQEDRHLEEE    281 - 350
LKCQEQKEEQLQEGVHRKEPQGAT                                                  351 - 374
//

Text Mined References (125)

PMID Year Title
26527150 2015 Structural insights into the interaction of human IgG1 with Fc?RI: no direct role of glycans in binding.
26406605 2015 Elevated Membrane and Soluble CD64: A Novel Marker Reflecting Altered Fc?R Function and Disease in Early Rheumatoid Arthritis That Can Be Regulated by Anti-Rheumatic Treatment.
26322411 2015 Monocyte HLA-DR expression and neutrophil CD64 expression as biomarkers of infection in critically ill neonates and infants.
26153451 2015 Structural consequences of aglycosylated IgG Fc variants evolved for Fc?RI binding.
26147145 2015 Neutrophil CD64 expression: a reliable diagnostic marker of infection in advanced cancer patients?
26025597 2015 A real-time PCR signature to discriminate between tuberculosis and other pulmonary diseases.
25925696 2015 Structural basis for binding of human IgG1 to its high-affinity human receptor Fc?RI.
25854904 2015 Diagnostic and prognostic value of sCD14-ST--presepsin for patients admitted to hospital intensive care unit (ICU).
25802446 2015 Aberrant expression of Fc?-receptors and Toll like receptor CD180 on monocytes from patients with chronic lymphocytic leukaemia.
25566870 2015 The high-affinity human IgG receptor Fc gamma receptor I (Fc?RI) is not associated with vascular leakage of dengue.
More...