Property Summary

Ligand Count 1
NCBI Gene PubMed Count 128
PubMed Score 1057.23
PubTator Score 1075.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 2.500 9.5e-65

 CSPA Cell Line (2)

Gene RIF (100)

AA Sequence

MWFLTTLLLWVPVDGQVDTTKAVITLQPPWVSVFQEETVTLHCEVLHLPGSSSTQWFLNGTATQTSTPSY      1 - 70
RITSASVNDSGEYRCQRGLSGRSDPIQLEIHRGWLLLQVSSRVFTEGEPLALRCHAWKDKLVYNVLYYRN     71 - 140
GKAFKFFHWNSNLTILKTNISHNGTYHCSGMGKHRYTSAGISVTVKELFPAPVLNASVTSPLLEGNLVTL    141 - 210
SCETKLLLQRPGLQLYFSFYMGSKTLRGRNTSSEYQILTARREDSGLYWCEAATEDGNVLKRSPELELQV    211 - 280
LGLQLPTPVWFHVLFYLAVGIMFLVNTVLWVTIRKELKRKKKWDLEISLDSGHEKKVISSLQEDRHLEEE    281 - 350
LKCQEQKEEQLQEGVHRKEPQGAT                                                  351 - 374
//

Text Mined References (134)

PMID Year Title