Property Summary

NCBI Gene PubMed Count 77
PubMed Score 122.37
PubTator Score 530.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
breast carcinoma -1.200 2.6e-03
fibroadenoma -1.700 1.1e-02
lung adenocarcinoma -1.100 1.1e-03
lung carcinoma 1.500 2.2e-19

Protein-protein Interaction (1)

Gene RIF (36)

AA Sequence

MPFSNSHNALKLRFPAEDEFPDLSAHNNHMAKVLTPELYAELRAKSTPSGFTLDDVIQTGVDNPGHPYIM      1 - 70
TVGCVAGDEESYEVFKDLFDPIIEDRHGGYKPSDEHKTDLNPDNLQGGDDLDPNYVLSSRVRTGRSIRGF     71 - 140
CLPPHCSRGERRAIEKLAVEALSSLDGDLAGRYYALKSMTEAEQQQLIDDHFLFDKPVSPLLLASGMARD    141 - 210
WPDARGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYI    211 - 280
LTCPSNLGTGLRAGVHIKLPNLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELV    281 - 350
QMVVDGVKLLIEMEQRLEQGQAIDDLMPAQK                                           351 - 381
//

Text Mined References (84)

PMID Year Title