Property Summary

NCBI Gene PubMed Count 74
Grant Count 40
R01 Count 29
Funding $3,592,244.45
PubMed Score 117.78
PubTator Score 530.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
breast carcinoma -1.200 0.003
fibroadenoma -1.700 0.011
lung adenocarcinoma -1.100 0.001
lung carcinoma 1.500 0.000

Gene RIF (33)

PMID Text
26460485 SRC, LYN and CKB expression or DNA methylation could be useful markers for predicting tumor progression.
25538032 CK-B catalytic activity also helps in the formation of protrusive ruffle structures which are actin-dependent and abundant on the surface of both unstimulated and LPS-activated macrophages.
25141318 CK-MB levels were higher after ERCP in non-ischemic patients compared with a myocardial ischemia group. Creatine phosphokinase levels did not differ significantly between groups.
24518563 increased serum Ckbb reflects failure of osteoclasts or suppression of osteoclasts in children with osteogenesis imperfecta during neridronate treatment
23882694 We found that most patients with macular telangiectasia-2 possess retinal autoantibodies, the most prevalent of which were directed against AGL, RBP3, and CK-B.
23876027 Estimation of CK and its CK isoenzyme fractions can aid in quick and accurate diagnosis of tubal ectopic pregnancy.
23049898 analysis of SNPs and their effect on creatine kinase structure and function
22885020 effects of osmolytes on human brain-type creatine kinase folding
22623148 study found promoter SNPs of CKB and TPI1 were weakly associated with schizophrenia;in addition, IFNG polymorphisms were associated with schizophrenia; results suggest that IFNG and proteins affected by IFNG may play a role in the pathogenesis of schizophrenia
22418839 His103 and Phe107 in hASB9-2 are essential for binding to CKB.
More...

AA Sequence

MPFSNSHNALKLRFPAEDEFPDLSAHNNHMAKVLTPELYAELRAKSTPSGFTLDDVIQTGVDNPGHPYIM      1 - 70
TVGCVAGDEESYEVFKDLFDPIIEDRHGGYKPSDEHKTDLNPDNLQGGDDLDPNYVLSSRVRTGRSIRGF     71 - 140
CLPPHCSRGERRAIEKLAVEALSSLDGDLAGRYYALKSMTEAEQQQLIDDHFLFDKPVSPLLLASGMARD    141 - 210
WPDARGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYI    211 - 280
LTCPSNLGTGLRAGVHIKLPNLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELV    281 - 350
QMVVDGVKLLIEMEQRLEQGQAIDDLMPAQK                                           351 - 381
//

Text Mined References (81)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26460485 2015 Deregulated Expression of SRC, LYN and CKB Kinases by DNA Methylation and Its Potential Role in Gastric Cancer Invasiveness and Metastasis.
25810257 2015 Creatine kinase B is necessary to limit myoblast fusion during myogenesis.
25538032 2015 Submembranous recruitment of creatine kinase B supports formation of dynamic actin-based protrusions of macrophages and relies on its C-terminal flexible loop.
25416956 2014 A proteome-scale map of the human interactome network.
25141318 2014 Role of serum myeloperoxidase, CPK, CK-MB, and cTnI tests in early diagnosis of myocardial ischemia during ERCP.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24518563 2014 Serum brain-type creatine kinase increases in children with osteogenesis imperfecta during neridronate treatment.
23882694 2013 Anti-retinal antibodies in patients with macular telangiectasia type 2.
23876027 2013 Diagnostic significance of total creatine kinase and its isoform in tubal ectopic pregnancy.
More...