Property Summary

NCBI Gene PubMed Count 55
Grant Count 37
R01 Count 23
Funding $4,734,563.17
PubMed Score 349.09
PubTator Score 940.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
psoriasis -3.600 0.000
cutaneous lupus erythematosus -2.800 0.039
diabetes mellitus 1.200 0.001
cystic fibrosis -2.200 0.000
inflammatory breast cancer -6.000 0.009
breast carcinoma -1.100 0.004
chronic rhinosinusitis 2.976 0.007

Gene RIF (34)

PMID Text
26585492 In summary, this study suggests that PIP expression regulates the process of cell adhesion in breast cancer.
25919462 GCDFP15 in stratum corneum is a potential marker for dysregulated sweating in atopic dermatitis.
25472539 PIP is a breast cancer-related protein that is expressed in a majority of breast tumors and has a significant function in the biology of this disease. [review]
25425335 The commonly used breast carcinoma biomarkers vary in their prognostic implications. GCDFP-15 independently indicated a favourable prognosis. GATA-3 and MGB were not associated with outcome.
25405607 Data indicate the potential role of Gross cystic disease fluid protein-15/prolactin-inducible protein (GCDFP-15/PIP) as a biomarker for keratoconus (KC)disease.
25070172 GCDFP-15 expression is higher in tumors with favorable prognostic features. GCDFP-15 expression is further a frequent feature of androgen receptor positive tumors and the molecular apocrine subtype.
24862759 PIP is required for cell cycle progression in breast cancer and provides a rationale for exploring PIP inhibition as a therapeutic approach in breast cancer that can potentially target microtubule polymerization.
24272937 Report GCDFP15 expression in metastatic basal-like triple negative breast carcinomas.
24114735 AZGP1 and PIP were found in significantly lower levels in invasive breast tissue.
23755096 The roles of PIP in the related T47D breast cancer cell line, were investigated.
More...

AA Sequence

MRLLQLLFRASPATLLLVLCLQLGANKAQDNTRKIIIKNFDIPKSVRPNDEVTAVLAVQTELKECMVVKT      1 - 70
YLISSIPLQGAFNYKYTACLCDDNPKTFYWDFYTNRTVQIAAVVDVIRELGICPDDAAVIPIKNNRFYTI     71 - 140
EILKVE                                                                    141 - 146
//

Text Mined References (59)

PMID Year Title
26585492 2015 Prolactin-Induced Protein regulates cell adhesion in breast cancer.
25946035 2015 Human Basal Tear Peptidome Characterization by CID, HCD, and ETD Followed by in Silico and in Vitro Analyses for Antimicrobial Peptide Identification.
25919462 2015 Gross cystic disease fluid protein 15 in stratum corneum is a potential marker of decreased eccrine sweating for atopic dermatitis.
25472539 2015 Prolactin-induced protein in breast cancer.
25425335 2015 GATA-binding protein 3, gross cystic disease fluid protein-15 and mammaglobin have distinct prognostic implications in different invasive breast carcinoma subgroups.
25405607 2014 Gross cystic disease fluid protein-15/prolactin-inducible protein as a biomarker for keratoconus disease.
25070172 2014 Gross cystic disease fluid protein 15 (GCDFP-15) expression in breast cancer subtypes.
24862759 2014 Prolactin-induced protein is required for cell cycle progression in breast cancer.
24272937 2014 Are mammaglobin and GCDFP-15 sensitive markers for diagnosis of metastatic basal-like triple negative breast carcinomas?
24248522 2014 Salivary protein profiles are linked to bitter taste acceptance in infants.
More...