Property Summary

NCBI Gene PubMed Count 60
PubMed Score 361.95
PubTator Score 940.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Breast cancer -2.200 8.8e-03
breast carcinoma -1.100 3.8e-03
chronic rhinosinusitis 2.976 6.7e-03
cutaneous lupus erythematosus -2.800 3.9e-02
cystic fibrosis -1.300 9.0e-04
diabetes mellitus 1.200 1.1e-03
psoriasis -2.600 1.3e-06

 GWAS Trait (2)

Gene RIF (38)

AA Sequence

MRLLQLLFRASPATLLLVLCLQLGANKAQDNTRKIIIKNFDIPKSVRPNDEVTAVLAVQTELKECMVVKT      1 - 70
YLISSIPLQGAFNYKYTACLCDDNPKTFYWDFYTNRTVQIAAVVDVIRELGICPDDAAVIPIKNNRFYTI     71 - 140
EILKVE                                                                    141 - 146
//

Text Mined References (64)

PMID Year Title